Lus10021067 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06690 213 / 2e-70 WCRKC1 WCRKC thioredoxin 1 (.1.2)
AT5G04260 146 / 1e-44 WCRKC2 WCRKC thioredoxin 2 (.1)
AT4G03520 61 / 1e-11 ATHM2 Thioredoxin superfamily protein (.1.2)
AT3G15360 61 / 1e-11 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
AT1G19730 59 / 2e-11 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1)
AT1G03680 59 / 6e-11 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1)
AT5G39950 54 / 2e-09 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
AT1G45145 51 / 2e-08 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1)
AT5G42980 50 / 2e-08 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1)
AT1G76760 51 / 5e-08 ATY1, TRX-Y1 thioredoxin Y1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017244 260 / 2e-89 AT5G06690 156 / 2e-48 WCRKC thioredoxin 1 (.1.2)
Lus10038703 137 / 3e-40 AT5G04260 191 / 2e-61 WCRKC thioredoxin 2 (.1)
Lus10037975 120 / 1e-35 AT5G04260 149 / 3e-47 WCRKC thioredoxin 2 (.1)
Lus10029755 56 / 7e-10 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10029752 56 / 1e-09 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10042784 56 / 1e-09 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10013827 54 / 2e-09 AT3G53220 172 / 2e-56 Thioredoxin superfamily protein (.1)
Lus10005258 53 / 6e-09 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Lus10030666 52 / 2e-08 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G059500 215 / 1e-71 AT5G06690 212 / 4e-70 WCRKC thioredoxin 1 (.1.2)
Potri.010G225701 150 / 7e-46 AT5G04260 204 / 3e-67 WCRKC thioredoxin 2 (.1)
Potri.008G036400 149 / 1e-45 AT5G04260 216 / 8e-72 WCRKC thioredoxin 2 (.1)
Potri.001G401500 59 / 8e-11 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Potri.019G111200 59 / 8e-11 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2)
Potri.013G132200 57 / 3e-10 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2)
Potri.017G076700 56 / 5e-10 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Potri.002G073000 55 / 2e-09 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2)
Potri.005G186800 54 / 3e-09 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2)
Potri.001G159000 54 / 5e-09 AT2G35010 162 / 7e-51 thioredoxin O1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10021067 pacid=23182297 polypeptide=Lus10021067 locus=Lus10021067.g ID=Lus10021067.BGIv1.0 annot-version=v1.0
ATGGCTGCAACTGCTGCTTTGACGACGGCGTGTTCTCCCATAATCCCCTCTCGAGAGTTTAACAGCAAATACCAACATCAACAACAACTGGGATTAAGCA
GCTGCTCCCTCTTCAGCACCGCTTCCTCTTCTTCTTCTTCGTATACTGGGAGAAGAAATAACAGAGAGCATTATCAGGGGAGGAAAGTTTCCGACTTTAG
AGCTTTCGGGTTCTGGCCCGATTTGAGATCCAAACCCACTTCCGTCGACATGGAACCCATCAACGATTCGGAGGAGCTGGATCAGATCCTTCTCCACGCT
AAGGAGCTCGCTCAACCTGTCGTCATCGACTGGATGGCGTCGTGGTGCAGGAAGTGCATATACTTAAAGCCTAAGCTGGAGAAATTAGCTGCTGAATTCG
ACGACAAAGCGAAGTTCTACTGCGTGGATGTGAACAAGGTGCCTCAGGCTCTGGTGAAGCGTGGCAACATATCTAAAATGCCGACGATTCAGGTGTGGAA
AGACGGGGAGATGAAGGAGGAGGTGATTGGAGGGCACAAAGGGTGGCTGGTGGTTGAAGAGGTTCAAGCTATGATCCACAAGTTCTTGTGA
AA sequence
>Lus10021067 pacid=23182297 polypeptide=Lus10021067 locus=Lus10021067.g ID=Lus10021067.BGIv1.0 annot-version=v1.0
MAATAALTTACSPIIPSREFNSKYQHQQQLGLSSCSLFSTASSSSSSYTGRRNNREHYQGRKVSDFRAFGFWPDLRSKPTSVDMEPINDSEELDQILLHA
KELAQPVVIDWMASWCRKCIYLKPKLEKLAAEFDDKAKFYCVDVNKVPQALVKRGNISKMPTIQVWKDGEMKEEVIGGHKGWLVVEEVQAMIHKFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06690 WCRKC1 WCRKC thioredoxin 1 (.1.2) Lus10021067 0 1
AT3G52070 unknown protein Lus10029504 1.4 0.9280
AT5G23240 DNAJ heat shock N-terminal dom... Lus10008768 1.4 0.9286
AT5G52780 Protein of unknown function (D... Lus10038849 3.2 0.8587
AT5G48250 CO COL10 B-box type zinc finger protein... Lus10036419 4.0 0.8657
AT5G59750 DHBP synthase RibB-like alpha/... Lus10005882 7.5 0.8145
AT5G45360 F-box family protein (.1) Lus10007767 9.9 0.8059
AT4G25170 Uncharacterised conserved prot... Lus10009654 11.2 0.8876
AT3G51880 AtHMGB1, NFD1, ... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10040192 12.0 0.8401
Lus10027443 12.4 0.8123
AT2G47400 CP12-1 CP12 domain-containing protein... Lus10010006 13.2 0.8583

Lus10021067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.