Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48905 44 / 5e-07 LCR12 low-molecular-weight cysteine-rich 12 (.1) AT2G22121 41 / 5e-06 LCR35 low-molecular-weight cysteine-rich 35 (.1) AT4G29273 39 / 2e-05 LCR23 low-molecular-weight cysteine-rich 23 (.1) AT4G29280 35 / 0.0005 LCR22 low-molecular-weight cysteine-rich 22 (.1) AT4G29290 35 / 0.0007 LCR26 low-molecular-weight cysteine-rich 26 (.1) AT4G13095 35 / 0.0007 LCR37 low-molecular-weight cysteine-rich 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017233 [exp] 165 / 3e-55 AT5G48905 42 / 1e-06 low-molecular-weight cysteine-rich 12 (.1) Lus10015984 [exp] 40 / 1e-05 AT4G29280 47 / 1e-08 low-molecular-weight cysteine-rich 22 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G195532 [exp] 44 / 5e-07 AT4G29280 46 / 5e-08 low-molecular-weight cysteine-rich 22 (.1) Potri.001G401800 [exp] 41 / 3e-06 AT4G09153 43 / 5e-07 low-molecular-weight cysteine-rich 36 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF07333 [flax] [poplar] SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence Show only first row Show all	>Lus10021078 pacid=23182284 polypeptide=Lus10021078 locus=Lus10021078.g ID=Lus10021078.BGIv1.0 annot-version=v1.0 ATGGCGAAGCATCAGCAATCAGTCCTCTTCATTCTCCTCCTCGTCTCAGTTGGAGTGATGGTAGTGGCACCAAAGGCTGCAGAAGCTACGATAGGAGCGT GTTCCATCGAGCTGAACCCCAACGGTTGCACAATGCCAGGATGCCAGGAACAGTGCTTCCTGGACCATGGTGGTTGGGGACACTGCGCTCACGATGCCGC CACTGGTATCTTCCATTGCGTCTGCTTCTACTCTTGTCCTCGCCCCTGA
AA sequence Show only first row Show all	>Lus10021078 pacid=23182284 polypeptide=Lus10021078 locus=Lus10021078.g ID=Lus10021078.BGIv1.0 annot-version=v1.0 MAKHQQSVLFILLLVSVGVMVVAPKAAEATIGACSIELNPNGCTMPGCQEQCFLDHGGWGHCAHDAATGIFHCVCFYSCPRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48905		LCR12	low-molecular-weight cysteine-...		Lus10021078 [exp]	0	1
AT3G07525		ATG10, ATATG10	autophagy 10, autophagocytosis...		Lus10002145 [exp]	3.0	0.8675
AT3G57930			unknown protein		Lus10031806 [exp]	3.2	0.9046
AT2G40435			unknown protein		Lus10017415 [exp]	3.9	0.8965
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10042095 [exp]	4.7	0.9010
AT1G14930			Polyketide cyclase/dehydrase a...		Lus10042490 [exp]	5.0	0.8840
AT5G19370			rhodanese-like domain-containi...		Lus10026105 [exp]	8.0	0.8440
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10035467 [exp]	9.2	0.8844
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10028440 [exp]	10.1	0.8281
					Lus10040805 [exp]	10.9	0.8077
AT5G19875			unknown protein		Lus10006311 [exp]	13.3	0.8682

Compare expression of checked genes

Lus10021078 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.