Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55210 116 / 6e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT5G49040 115 / 2e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 115 / 2e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 110 / 2e-30 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 109 / 3e-30 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 105 / 1e-28 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 104 / 4e-28 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 109 / 1e-27 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3) AT3G13662 97 / 2e-25 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G38700 95 / 2e-24 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017228 [exp] 323 / 3e-114 AT1G55210 119 / 8e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Lus10029306 [exp] 124 / 1e-35 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 118 / 2e-33 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10026176 [exp] 115 / 4e-32 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 114 / 6e-32 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 113 / 2e-31 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021083 [exp] 109 / 6e-30 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10032939 [exp] 101 / 7e-27 AT5G42500 139 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 96 / 2e-24 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G195300 [exp] 132 / 8e-39 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 127 / 4e-37 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 125 / 3e-36 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G061000 [exp] 121 / 9e-35 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 120 / 1e-34 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216400 [exp] 120 / 4e-34 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 117 / 2e-33 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 117 / 7e-33 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.003G216200 [exp] 105 / 2e-28 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.001G009100 [exp] 103 / 2e-27 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10021082 pacid=23182414 polypeptide=Lus10021082 locus=Lus10021082.g ID=Lus10021082.BGIv1.0 annot-version=v1.0 ATGGCCAAGCTCATCCTCCATTCTTTCCTCACCACCACAACCCTCCTCCTCCTCCTGTCATCCACATCCTTCTCCTCCGCCGCCACCAAAAAACCCACCT CCGACGGTGGCTTCTCCACGAAGCTCTCCCGCGAAGAGTTCGGCCTCGACAAGGAAGAGAAGCTCACGCGCCTCCACTTCTACATGAGTGACTTCTTCGG GGGCGAGAACGCCACCGCCATCCCCGTCACCAACGTCCTCGACAACAACACCTTCTACGGCGGCATTTACTTGGCCGACGACGCGTTGACCTTGGGACCC GAGCTGAACTCCACGTCTGTCGGGACGGGCAGGGGATTCTACAGCTTCCCTTCCCCAAACGACTTCGTTTTGGAGATGGTGTACAACTTGGCGTTCACCC ACGGAGCGTATAATGGGAGCACGTTGACCCTTGTGGGCCCCATCCACCCGCGATCGATCGTCAACGAGCTGTCAATCGTGGGTGGGACCGGGGATTTCCG GTTCGGTCGTGGATACGCCGTTGCTAAAAGGACCGTGCTCGATTTTCAAGCGCTGCTCGTTGTCCGGGAGTTTGACGTTTATGTTTCACACTATTAA
AA sequence Show only first row Show all	>Lus10021082 pacid=23182414 polypeptide=Lus10021082 locus=Lus10021082.g ID=Lus10021082.BGIv1.0 annot-version=v1.0 MAKLILHSFLTTTTLLLLLSSTSFSSAATKKPTSDGGFSTKLSREEFGLDKEEKLTRLHFYMSDFFGGENATAIPVTNVLDNNTFYGGIYLADDALTLGP ELNSTSVGTGRGFYSFPSPNDFVLEMVYNLAFTHGAYNGSTLTLVGPIHPRSIVNELSIVGGTGDFRFGRGYAVAKRTVLDFQALLVVREFDVYVSHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G49040			Disease resistance-responsive ...		Lus10021082 [exp]	0	1
AT1G55210			Disease resistance-responsive ...		Lus10017228 [exp]	2.0	0.9577
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024626 [exp]	3.6	0.9618
AT5G06490			RING/U-box superfamily protein...		Lus10008972 [exp]	3.9	0.9571
					Lus10039865 [exp]	4.5	0.9327
AT3G01190			Peroxidase superfamily protein...		Lus10018374 [exp]	6.7	0.9369
AT4G10350	NAC	BRN2, NST4, ANA...	BEARSKIN 2, NAC domain contain...		Lus10013782 [exp]	8.5	0.9477
AT1G04220		KCS2	3-ketoacyl-CoA synthase 2 (.1)		Lus10039399 [exp]	13.6	0.9519
AT5G55410			Bifunctional inhibitor/lipid-t...		Lus10032575 [exp]	14.1	0.9510
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10021135 [exp]	15.0	0.9318
AT4G10350	NAC	BRN2, NST4, ANA...	BEARSKIN 2, NAC domain contain...		Lus10039153 [exp]	15.3	0.9442

Compare expression of checked genes

Lus10021082 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.