Lus10021083 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22900 148 / 4e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 147 / 8e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 142 / 3e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 141 / 1e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 128 / 2e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 124 / 6e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT5G49040 123 / 2e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 121 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 120 / 3e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G58090 119 / 5e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021084 262 / 8e-90 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029306 169 / 4e-53 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017231 154 / 1e-47 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 145 / 3e-44 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 145 / 8e-44 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10030483 132 / 9e-39 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10039561 129 / 2e-37 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 128 / 3e-37 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032939 127 / 7e-37 AT5G42500 139 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195300 176 / 4e-56 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 167 / 7e-53 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 166 / 3e-52 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 166 / 4e-52 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 158 / 5e-49 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216400 158 / 7e-49 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G131000 144 / 7e-44 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 140 / 5e-42 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G009100 139 / 2e-41 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060801 137 / 3e-41 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10021083 pacid=23182296 polypeptide=Lus10021083 locus=Lus10021083.g ID=Lus10021083.BGIv1.0 annot-version=v1.0
ATGGCCAAGCTGATCATGATCACCAACGTTCTTCTCATCCTCCTCCTCTCCATCCCTACAATTACCACAAGCTCCACCACCCATACCTTCTCCAGAAAAG
CATCCAAGGAAACCCTAGGGCTAGCCAGAGAAACGCAAACCCACCTCCATTTCTACGTCCACGACATCGTCACCGGCCCGGAACCAACCCCGACAGCTTA
CCCGCTCAACCTGAACACCCTCCCCAGCATCGTCAACTCCTCGACCCTCTTCGGGGTGATGGCCATGGTCGACGATCCTCTGACTGTGGGGCCCGAGTTC
GACTCCAAGCTGGTCGGCAGAGCTCAGGGGATGTACGGAAGCGCTTCCTTGACCGGAGAGACGACGCTCTTCCTCGTGTCCAACTTCGTGTTCACTGAGG
GGGAGTACAAAGGGAGCACGCTCAGCTTTAACGGACGTAACCCCATCTTAGCTGACGTTAGGGAGTGGCCGATCGTCGGCGGGACTGGGGTTTTCCGGTT
CGCCAGAGGGTATGCCGTGGTGAAGCCGTATTCGGTTGATACGGTGAAGCTTAATGCTGTTCTGGAGCTTGATGTCTATGTTACTCATTATTATTAA
AA sequence
>Lus10021083 pacid=23182296 polypeptide=Lus10021083 locus=Lus10021083.g ID=Lus10021083.BGIv1.0 annot-version=v1.0
MAKLIMITNVLLILLLSIPTITTSSTTHTFSRKASKETLGLARETQTHLHFYVHDIVTGPEPTPTAYPLNLNTLPSIVNSSTLFGVMAMVDDPLTVGPEF
DSKLVGRAQGMYGSASLTGETTLFLVSNFVFTEGEYKGSTLSFNGRNPILADVREWPIVGGTGVFRFARGYAVVKPYSVDTVKLNAVLELDVYVTHYY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22900 Disease resistance-responsive ... Lus10021083 0 1
AT5G05340 Peroxidase superfamily protein... Lus10009936 2.8 0.7601
Lus10007605 3.0 0.7123
AT1G24540 CYP86C1 "cytochrome P450, family 86, s... Lus10036880 10.5 0.6893
AT5G51490 Plant invertase/pectin methyle... Lus10027203 11.8 0.7065
AT3G01190 Peroxidase superfamily protein... Lus10007638 16.2 0.7592
Lus10039943 16.7 0.6818
AT1G50560 CYP705A25 "cytochrome P450, family 705, ... Lus10015706 17.3 0.6497
AT1G32910 HXXXD-type acyl-transferase fa... Lus10006333 33.4 0.6035
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10007603 33.7 0.5884
AT1G68630 PLAC8 family protein (.1) Lus10008890 39.7 0.6629

Lus10021083 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.