Lus10021084 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42500 154 / 9e-48 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 151 / 1e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 150 / 6e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 148 / 3e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 143 / 2e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT3G13650 139 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 138 / 2e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 136 / 2e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 134 / 7e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G58090 134 / 6e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021083 241 / 1e-81 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029306 169 / 3e-53 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017231 156 / 1e-48 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 147 / 8e-45 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 145 / 4e-44 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016237 133 / 4e-40 AT1G58170 149 / 6e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10039561 134 / 1e-39 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10030483 132 / 1e-38 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016231 130 / 3e-38 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195300 179 / 3e-57 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 175 / 1e-55 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 173 / 7e-55 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 165 / 7e-52 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216400 164 / 3e-51 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 161 / 2e-50 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G131000 158 / 3e-49 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060801 155 / 4e-48 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 150 / 4e-46 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 146 / 2e-44 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10021084 pacid=23182439 polypeptide=Lus10021084 locus=Lus10021084.g ID=Lus10021084.BGIv1.0 annot-version=v1.0
ATGGCCAAACTCACCAACCTTGTTCTTCTTACACCTCTAATCCTTCTCCTCCTCGCCACCATTTCCACAAGCTCCACTCACACCCACACCTTCTCCAGAA
AGTTAGCATCCAGGAAAGCCCTAAGTCTGACGAGGGAGACGCAAACCCACCTCCATTTCTACTTCCACGACATCATAACGGCCCCGCCGACCCCAACAGC
TTACCCGCTCAACATAAACGCCCTCCCGAGCATCGTCAACTCGTCGACCCTCTTCGGGGTGATGGTCATGGCCGACGATCCCCTGACTGCGGGGCCCGAA
TTCAACTCCACGCTGGTGGGGAGAGCTCAGGGGATGTACGGAAGCGCTTCCTTCGGAGAGACGGCGTTCTTCATGGTGTTCAACTTCGTGTTCACCGCGG
GAGAGTACAAAGGGAGCACGCTCAGCTTGTACGGACGCAACGCCATCTTAGCCGACGTCAGGGAGATGCCCATCGTCGGAGGGACTGGGGTTTTCCGGTT
TGCTAGAGGGTATGCCGAGGCCAGGACGTACTCGGTTGATACGGCGACGTTTAATGCGGTTGTGGAGTTCGATGTATATGTTACTCATTATTCTTAG
AA sequence
>Lus10021084 pacid=23182439 polypeptide=Lus10021084 locus=Lus10021084.g ID=Lus10021084.BGIv1.0 annot-version=v1.0
MAKLTNLVLLTPLILLLLATISTSSTHTHTFSRKLASRKALSLTRETQTHLHFYFHDIITAPPTPTAYPLNINALPSIVNSSTLFGVMVMADDPLTAGPE
FNSTLVGRAQGMYGSASFGETAFFMVFNFVFTAGEYKGSTLSLYGRNAILADVREMPIVGGTGVFRFARGYAEARTYSVDTATFNAVVEFDVYVTHYS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42500 Disease resistance-responsive ... Lus10021084 0 1
AT4G12470 AZI1 azelaic acid induced 1 (.1) Lus10032261 3.3 0.9350
AT2G02310 ATPP2-B6 phloem protein 2-B6 (.1) Lus10003445 3.9 0.8993
AT1G75717 unknown protein Lus10033147 14.9 0.8670
AT1G14185 Glucose-methanol-choline (GMC)... Lus10012817 15.0 0.8864
Lus10014263 17.9 0.8697
AT1G53130 GRI GRIM REAPER, Stigma-specific S... Lus10005544 19.6 0.9051
AT2G02061 Nucleotide-diphospho-sugar tra... Lus10031903 21.2 0.8928
AT5G51480 SKS2 SKU5 similar 2 (.1) Lus10038920 24.7 0.8989
AT5G51310 2-oxoglutarate (2OG) and Fe(II... Lus10009025 28.9 0.8587
AT2G23630 SKS16 SKU5 similar 16 (.1) Lus10000837 31.1 0.8793

Lus10021084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.