Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16950 79 / 1e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026852 [exp] 158 / 6e-52 AT5G16950 104 / 8e-31 unknown protein Lus10017219 [exp] 103 / 2e-30 ND 40 / 5e-10
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G082000 [exp] 129 / 1e-40 AT5G16950 91 / 2e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021093 pacid=23182421 polypeptide=Lus10021093 locus=Lus10021093.g ID=Lus10021093.BGIv1.0 annot-version=v1.0 ATGGGATCTGAAGAGCATAAGGATCCATTGAAAGGGGTGGATTGGAAAGCAATAGGTACTGAGCTTCAAAAAGACCCAAGTGCTGGCACGAAACAAGTAG TTAAGAAGCGGCTACCCAAAAGGATCAGGCAGATTCCTGAAAGCTATTTCCTTCCACGAATGTCCTGGCCCTCTGCCATCGGCTTCTATGGTGCTTGTAT AGCTGGTGGGATTGGGGCTGGCATGCTGGTAGAGATGTGGATTAACAAGAAAGTCAAAGATGATGGTGGCGTTATATGGGAGTTTGATAAGTAA
AA sequence Show only first row Show all	>Lus10021093 pacid=23182421 polypeptide=Lus10021093 locus=Lus10021093.g ID=Lus10021093.BGIv1.0 annot-version=v1.0 MGSEEHKDPLKGVDWKAIGTELQKDPSAGTKQVVKKRLPKRIRQIPESYFLPRMSWPSAIGFYGACIAGGIGAGMLVEMWINKKVKDDGGVIWEFDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16950			unknown protein		Lus10021093 [exp]	0	1
AT3G60820		PBF1	N-terminal nucleophile aminohy...		Lus10015867 [exp]	2.2	0.9186
AT5G16870			Peptidyl-tRNA hydrolase II (PT...		Lus10009246 [exp]	5.5	0.9131
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10013049 [exp]	5.7	0.8721
AT1G31812		ACBP6, ACBP	acyl-CoA-binding protein 6 (.1...		Lus10013605 [exp]	5.7	0.8599
AT5G20500			Glutaredoxin family protein (....		Lus10017148 [exp]	6.0	0.9173
AT1G24050			RNA-processing, Lsm domain (.1...		Lus10010705 [exp]	9.0	0.8866
AT3G25220		FKBP15-1	FK506-binding protein 15 kD-1 ...		Lus10003170 [exp]	9.2	0.8925
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Lus10043147 [exp]	9.9	0.8544
AT1G49390			2-oxoglutarate (2OG) and Fe(II...		Lus10008824 [exp]	10.0	0.9062
AT4G26210			Mitochondrial ATP synthase sub...		Lus10007995 [exp]	10.6	0.8895

Compare expression of checked genes

Lus10021093 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.