Lus10021098 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18420 76 / 3e-19 Gibberellin-regulated family protein (.1)
AT1G75750 74 / 1e-18 GASA1 GAST1 protein homolog 1 (.1.2)
AT4G09600 65 / 3e-15 GASA3 GAST1 protein homolog 3 (.1)
AT1G22690 59 / 1e-12 Gibberellin-regulated family protein (.1.2.3)
AT5G14920 53 / 2e-09 Gibberellin-regulated family protein (.1.2)
AT2G39540 42 / 3e-06 Gibberellin-regulated family protein (.1)
AT4G09610 40 / 1e-05 GASA2 GAST1 protein homolog 2 (.1)
AT2G14900 40 / 2e-05 Gibberellin-regulated family protein (.1)
AT5G59845 39 / 2e-05 Gibberellin-regulated family protein (.1)
AT1G10588 39 / 3e-05 Gibberellin-regulated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017212 103 / 2e-30 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10024338 75 / 5e-19 ND 78 / 3e-20
Lus10025962 64 / 9e-15 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10014262 61 / 3e-13 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10034524 59 / 1e-12 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10009421 60 / 2e-12 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10039443 59 / 6e-12 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2)
Lus10033145 54 / 6e-11 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10024791 42 / 4e-06 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G239000 82 / 1e-21 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.005G239100 76 / 1e-19 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022600 74 / 1e-18 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022500 74 / 3e-18 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.012G076700 69 / 1e-16 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.002G022700 68 / 2e-16 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.015G071500 66 / 1e-15 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.013G113400 57 / 5e-12 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Potri.019G083900 57 / 6e-12 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.001G350600 57 / 6e-11 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Lus10021098 pacid=23182319 polypeptide=Lus10021098 locus=Lus10021098.g ID=Lus10021098.BGIv1.0 annot-version=v1.0
ATGGCTTTCTCAAAGTTAATCATGGCTTCCCTTCTTCTCTCCCTCGTCGTCCTCCAGCTTACCCTGCATGCTGCTGCTGCTGCTGCTGCTGATAGCTACC
CCGGTACTCCAACCACCGACTGTAAGGGCGCGTGCAAGGCGAGGTGTCGGCTGTCGAGCAGGCCAAACCTATGCCACAGGGCTTGTGGAACTTGCTGCAA
AAGATGCAGCTGCGTCCCTCCCGGTACCGCCGGCAACTATGACAAGAGTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAG
AA sequence
>Lus10021098 pacid=23182319 polypeptide=Lus10021098 locus=Lus10021098.g ID=Lus10021098.BGIv1.0 annot-version=v1.0
MAFSKLIMASLLLSLVVLQLTLHAAAAAAADSYPGTPTTDCKGACKARCRLSSRPNLCHRACGTCCKRCSCVPPGTAGNYDKSXXXXXXXXXX

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18420 Gibberellin-regulated family p... Lus10021098 0 1
AT1G78860 D-mannose binding lectin prote... Lus10022495 4.6 0.9206
AT5G44390 FAD-binding Berberine family p... Lus10001965 7.3 0.9293
AT4G15560 AtCLA1, DXS, DX... 1-DEOXY-D-XYLULOSE 5-PHOSPHATE... Lus10015519 8.5 0.9215
AT3G51660 Tautomerase/MIF superfamily pr... Lus10012222 13.0 0.8997
AT2G19500 ATCKX2, CKX2 cytokinin oxidase 2 (.1) Lus10031200 16.9 0.8839
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10019457 22.7 0.9165
AT4G03140 NAD(P)-binding Rossmann-fold s... Lus10029370 24.6 0.8888
AT4G29700 Alkaline-phosphatase-like fami... Lus10000041 26.7 0.9161
AT5G24090 ATCHIA chitinase A (.1) Lus10027560 28.1 0.8820
AT3G47550 RING/FYVE/PHD zinc finger supe... Lus10019102 33.6 0.9136

Lus10021098 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.