Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017210 [exp] 137 / 5e-44 ND / Lus10022600 [exp] 92 / 4e-26 ND / Lus10021499 [exp] 89 / 6e-25 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092300 [exp] 62 / 1e-14 ND / Potri.016G103900 [exp] 61 / 8e-14 ND / Potri.010G196500 [exp] 52 / 2e-10 ND / Potri.008G061600 [exp] 46 / 7e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021100 pacid=23182435 polypeptide=Lus10021100 locus=Lus10021100.g ID=Lus10021100.BGIv1.0 annot-version=v1.0 ATGGCGGCTAATCTTCGTATCTCTCATCTCCTCCTCCTTCTATTACTCACCCTCTCCACAACAACAAACAACTCAAGAGCCGCTGAGGCCAGAACACTTC CTTTCTCATCTCTTCACCTTGGGTCTTCCAAGATATTTGCAACGCTGGGAGTGGTATGCAAGTGTTGTGATAATAGACAGTCTGAAACTAACGGTGAATG TTCCAGCTCCTGGGAAAAAGGGTCTTGCCGCGATGTCCAGTGCCTTCCCTGGAGAATCGGATAA
AA sequence Show only first row Show all	>Lus10021100 pacid=23182435 polypeptide=Lus10021100 locus=Lus10021100.g ID=Lus10021100.BGIv1.0 annot-version=v1.0 MAANLRISHLLLLLLLTLSTTTNNSRAAEARTLPFSSLHLGSSKIFATLGVVCKCCDNRQSETNGECSSSWEKGSCRDVQCLPWRIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021100 [exp]	0	1
AT2G29050		ATRBL1	RHOMBOID-like 1 (.1.2)		Lus10023789 [exp]	1.0	0.9152
AT5G46080			Protein kinase superfamily pro...		Lus10025455 [exp]	2.2	0.9065
AT3G52880		ATMDAR1	monodehydroascorbate reductase...		Lus10008633 [exp]	2.8	0.9108
AT1G63420			Arabidopsis thaliana protein o...		Lus10024519 [exp]	3.0	0.9146
AT1G76360			Protein kinase superfamily pro...		Lus10013223 [exp]	3.7	0.9148
AT3G09760			RING/U-box superfamily protein...		Lus10026501 [exp]	5.3	0.8959
AT3G09010			Protein kinase superfamily pro...		Lus10011193 [exp]	6.7	0.8849
AT5G01830			ARM repeat superfamily protein...		Lus10006090 [exp]	8.1	0.8863
AT1G13700		PGL1	6-phosphogluconolactonase 1 (....		Lus10036919 [exp]	9.8	0.8399
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10041799 [exp]	10.2	0.8591

Compare expression of checked genes

Lus10021100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.