Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53990 215 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03270 170 / 8e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 166 / 2e-53 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G09740 71 / 7e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 69 / 8e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G11930 67 / 3e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G11360 68 / 4e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G62550 65 / 1e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G54430 63 / 2e-12 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT4G27320 57 / 3e-10 ATPHOS34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017207 [exp] 322 / 7e-115 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10022602 [exp] 287 / 4e-101 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021501 [exp] 195 / 5e-65 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10037761 [exp] 162 / 2e-51 AT3G17020 224 / 4e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10016900 [exp] 167 / 1e-49 AT3G17020 229 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 66 / 1e-13 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 64 / 2e-13 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 64 / 3e-13 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 61 / 4e-12 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092700 [exp] 231 / 6e-79 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.016G104600 [exp] 226 / 4e-77 AT3G53990 229 / 6e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.017G144301 [exp] 181 / 3e-59 AT3G03270 248 / 9e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G144100 [exp] 176 / 4e-57 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.004G075375 [exp] 175 / 9e-57 AT3G03270 243 / 9e-84 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.002G104700 [exp] 72 / 2e-16 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 72 / 4e-16 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 66 / 7e-14 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.002G196700 [exp] 64 / 3e-13 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.011G039800 [exp] 65 / 5e-13 AT1G11360 269 / 3e-91 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10021104 pacid=23182331 polypeptide=Lus10021104 locus=Lus10021104.g ID=Lus10021104.BGIv1.0 annot-version=v1.0 ATGGGGAAAGACAAGACGATCGGAGTAGCAATGGACTTCTCCGCCAGCAGCAAGAACGCCCTCAAATGGGCTCTCGACAACTTGGCTGACAAAGGTGACA CCGTCTACATCATCCATGTCCACCCCCATGAACTCCCCGAGGGCAAACAGCAACTCTGGGGCAAGGCCGGCTCTCCTTTGATTCCGCTGTCCGAGTTCAG AGAGCCCGAAGTGATGAAAAGCTACGACCTGAAGCCCGATGCTGAGGTTCTCGATTTGCTCGACACTGCTACCAAGCAGAAAGAGATCAAAATTGTGGCG AAGCTTTACTGGGGAGGAGATGCGAGGGACAAGATCATTGACGCCATAGACGGGTTGAAGCTGGAGTCAATCGTCATGGGAAGCAGAGGGCTTGGAACTG TTAAGAGGATATTGATGGGGAGCGTGAGCTCGTATGTGATGAACACGGCTTCAATCCCAGTCACCATTGTGAAGGATAAGCACTGA
AA sequence Show only first row Show all	>Lus10021104 pacid=23182331 polypeptide=Lus10021104 locus=Lus10021104.g ID=Lus10021104.BGIv1.0 annot-version=v1.0 MGKDKTIGVAMDFSASSKNALKWALDNLADKGDTVYIIHVHPHELPEGKQQLWGKAGSPLIPLSEFREPEVMKSYDLKPDAEVLDLLDTATKQKEIKIVA KLYWGGDARDKIIDAIDGLKLESIVMGSRGLGTVKRILMGSVSSYVMNTASIPVTIVKDKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53990			Adenine nucleotide alpha hydro...		Lus10021104 [exp]	0	1
AT3G55520			FKBP-like peptidyl-prolyl cis-...		Lus10004714 [exp]	2.4	0.8396
AT1G56423			unknown protein		Lus10029844 [exp]	2.4	0.8907
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10040307 [exp]	2.8	0.8696
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10023428 [exp]	4.2	0.8658
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10009631 [exp]	4.5	0.8084
AT1G51200			A20/AN1-like zinc finger famil...		Lus10031833 [exp]	5.5	0.8341
AT3G47300		SELT	SELT-like protein precursor (....		Lus10040658 [exp]	6.0	0.8546
AT5G17060		ATARFB1B	ADP-ribosylation factor B1B (....		Lus10020392 [exp]	9.5	0.8392
AT5G46030			unknown protein		Lus10015293 [exp]	11.2	0.8470
AT1G54340		ICDH	isocitrate dehydrogenase (.1)		Lus10010431 [exp]	13.9	0.8188

Compare expression of checked genes

Lus10021104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.