Lus10021107 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59040 87 / 1e-22 COPT3 copper transporter 3 (.1)
AT2G26975 86 / 3e-22 Ctr copper transporter family (.1)
AT2G37925 84 / 3e-21 COPT4 copper transporter 4 (.1)
AT3G46900 83 / 7e-21 COPT2 copper transporter 2 (.1)
AT5G59030 82 / 1e-20 COPT1 copper transporter 1 (.1)
AT5G20650 54 / 4e-10 COPT5 copper transporter 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017205 248 / 2e-86 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1)
Lus10023045 122 / 3e-36 AT2G26975 84 / 2e-21 Ctr copper transporter family (.1)
Lus10032428 112 / 2e-32 AT2G26975 87 / 1e-22 Ctr copper transporter family (.1)
Lus10040726 88 / 8e-23 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1)
Lus10016464 86 / 8e-22 AT5G59030 151 / 1e-47 copper transporter 1 (.1)
Lus10021108 83 / 6e-21 AT2G37925 120 / 2e-35 copper transporter 4 (.1)
Lus10017204 57 / 3e-11 AT5G59030 88 / 3e-23 copper transporter 1 (.1)
Lus10012501 54 / 5e-10 AT5G20650 177 / 5e-58 copper transporter 5 (.1)
Lus10007092 52 / 3e-09 AT5G20650 169 / 6e-55 copper transporter 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G093200 129 / 4e-39 AT3G46900 89 / 6e-23 copper transporter 2 (.1)
Potri.009G038700 100 / 5e-28 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1)
Potri.006G093300 86 / 4e-22 AT2G37925 114 / 3e-33 copper transporter 4 (.1)
Potri.009G038800 86 / 6e-22 AT5G59030 148 / 4e-46 copper transporter 1 (.1)
Potri.001G246000 79 / 2e-19 AT5G59030 134 / 9e-41 copper transporter 1 (.1)
Potri.006G140700 61 / 2e-12 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
Potri.006G219200 53 / 2e-09 AT5G20650 140 / 1e-43 copper transporter 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04145 Ctr Ctr copper transporter family
Representative CDS sequence
>Lus10021107 pacid=23182300 polypeptide=Lus10021107 locus=Lus10021107.g ID=Lus10021107.BGIv1.0 annot-version=v1.0
ATGGACATGGGTTCGAATTCGACGGACGATACTTCGATGCACAATAGCTTCTTCTGGGGGAAAGACGTGGTCTTGCTCTTCTCCGGATGGCCGGACCACA
GTCTCCCTATGTACATTCTAGCATGTTTGTGTGTCTTCTTCATGACGGCTGGTGCAGAGTTCTTGACCCTTGCTCAATCGGTCAAGAGTTCGAAAAGTCC
GGCGGTTGGGGCCGCCGTTGAGGCGTGCTTTTATGCGGTCAAGATGGCTCTTTCCTATATGGTCATGTTGGCTGTCATGTCCTTCAATTTGGGGGTCTTC
ATCTCTGCCGTCCTCGGCCACTCCCTTGGCCTCTTCATCGTCAAGAGGAACAGTGTGACGCTGTATGAGAGGTTCAATGCCAATGGCCGGAATGGGAGTG
GATGA
AA sequence
>Lus10021107 pacid=23182300 polypeptide=Lus10021107 locus=Lus10021107.g ID=Lus10021107.BGIv1.0 annot-version=v1.0
MDMGSNSTDDTSMHNSFFWGKDVVLLFSGWPDHSLPMYILACLCVFFMTAGAEFLTLAQSVKSSKSPAVGAAVEACFYAVKMALSYMVMLAVMSFNLGVF
ISAVLGHSLGLFIVKRNSVTLYERFNANGRNGSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59040 COPT3 copper transporter 3 (.1) Lus10021107 0 1
AT1G68630 PLAC8 family protein (.1) Lus10008890 2.4 0.8065
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10030078 3.2 0.8115
AT5G27350 SFP1 Major facilitator superfamily ... Lus10035355 4.5 0.8081
AT2G23600 ATMES2, ACL, AT... ARABIDOPSIS THALIANA METHYL ES... Lus10038593 10.4 0.7476
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10021345 16.5 0.7383
AT5G42020 BIP2, BIP luminal binding protein, Heat ... Lus10017022 19.8 0.7311
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10038141 26.7 0.7749
AT3G16150 ASPGB1 asparaginase B1, N-terminal nu... Lus10024795 29.9 0.7764
AT4G21020 Late embryogenesis abundant pr... Lus10015427 31.2 0.6977
AT1G15190 Fasciclin-like arabinogalactan... Lus10003958 33.7 0.7828

Lus10021107 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.