Lus10021108 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G26975 119 / 6e-35 Ctr copper transporter family (.1)
AT2G37925 118 / 1e-34 COPT4 copper transporter 4 (.1)
AT5G59030 119 / 2e-34 COPT1 copper transporter 1 (.1)
AT3G46900 112 / 3e-32 COPT2 copper transporter 2 (.1)
AT5G59040 101 / 8e-28 COPT3 copper transporter 3 (.1)
AT5G20650 51 / 1e-08 COPT5 copper transporter 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017204 176 / 6e-58 AT5G59030 88 / 3e-23 copper transporter 1 (.1)
Lus10040726 139 / 1e-42 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1)
Lus10016464 130 / 5e-39 AT5G59030 151 / 1e-47 copper transporter 1 (.1)
Lus10016463 87 / 1e-22 AT2G26975 92 / 5e-25 Ctr copper transporter family (.1)
Lus10021107 83 / 9e-21 AT5G59040 87 / 1e-22 copper transporter 3 (.1)
Lus10017205 82 / 3e-20 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1)
Lus10023045 74 / 3e-17 AT2G26975 84 / 2e-21 Ctr copper transporter family (.1)
Lus10016462 71 / 5e-17 AT5G59030 76 / 3e-19 copper transporter 1 (.1)
Lus10032428 72 / 1e-16 AT2G26975 87 / 1e-22 Ctr copper transporter family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G093300 150 / 3e-47 AT2G37925 114 / 3e-33 copper transporter 4 (.1)
Potri.009G038700 140 / 4e-43 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1)
Potri.009G038800 135 / 3e-41 AT5G59030 148 / 4e-46 copper transporter 1 (.1)
Potri.001G246000 124 / 1e-36 AT5G59030 134 / 9e-41 copper transporter 1 (.1)
Potri.006G093200 99 / 6e-27 AT3G46900 89 / 6e-23 copper transporter 2 (.1)
Potri.006G140700 55 / 7e-10 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
Potri.006G219200 49 / 6e-08 AT5G20650 140 / 1e-43 copper transporter 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04145 Ctr Ctr copper transporter family
Representative CDS sequence
>Lus10021108 pacid=23182329 polypeptide=Lus10021108 locus=Lus10021108.g ID=Lus10021108.BGIv1.0 annot-version=v1.0
ATGCACACATCCCTAAATTCATCATCGGCGTCGTCACCAATCTCGTCGTCGTGGAACACAACTCCCGCCACGGCGGAGAAGCCGGAGGTCGGGGGTGGAA
TTCACGCCCGCGGGAATGCTCTGCTGCACACGAGCTTCTGGTGGGGACACAAGAAAGCCGAAATCCTGTTTCCGGGTTGGCCCGGGTCGGACCCGGGGAT
GTACGCCTGCGCACTGATGTTCGTTTTCTCGCTGGCGGTGGCGGTGGAGTGGCTGAGCTACTGCAGCATCGTGAAGCCCGGGACGAGTAGAGTCGCAGCT
GGGTTCTTTAAGACCGGGATGTTCGCCGTGCGTGCGGGTCTGTCGTATATGGTTATGCTGGCGGTTATGTCATACAACGGCGGCGTTTTCATCGTGGCGG
TGTTGGGCCACGCCGTGGGGTTTGTTCTGTTTGGGAGCTCGGTGTTGTGGAAGTCCGACAAGGTGCCGGATCTTCCCCAGCCCAAATGCTGA
AA sequence
>Lus10021108 pacid=23182329 polypeptide=Lus10021108 locus=Lus10021108.g ID=Lus10021108.BGIv1.0 annot-version=v1.0
MHTSLNSSSASSPISSSWNTTPATAEKPEVGGGIHARGNALLHTSFWWGHKKAEILFPGWPGSDPGMYACALMFVFSLAVAVEWLSYCSIVKPGTSRVAA
GFFKTGMFAVRAGLSYMVMLAVMSYNGGVFIVAVLGHAVGFVLFGSSVLWKSDKVPDLPQPKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G37925 COPT4 copper transporter 4 (.1) Lus10021108 0 1
AT5G22870 Late embryogenesis abundant (L... Lus10041350 1.0 0.9493
AT5G59030 COPT1 copper transporter 1 (.1) Lus10017204 1.7 0.9271
AT4G05220 Late embryogenesis abundant (L... Lus10006755 2.4 0.9443
AT5G35740 Carbohydrate-binding X8 domain... Lus10039059 4.5 0.9150
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10016566 11.2 0.8975
AT1G52570 PLDALPHA2 phospholipase D alpha 2 (.1) Lus10041787 13.4 0.9183
AT5G08391 Protein of unknown function (D... Lus10032032 14.5 0.8754
AT1G05610 APS2 ADP-glucose pyrophosphorylase ... Lus10042456 15.7 0.9095
AT1G10380 Putative membrane lipoprotein ... Lus10036687 15.7 0.9095
AT4G16640 Matrixin family protein (.1) Lus10004728 16.5 0.8960

Lus10021108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.