Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09085 153 / 1e-49 Protein of unknown function (DUF962) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017182 [exp] 208 / 3e-71 AT3G09085 162 / 4e-53 Protein of unknown function (DUF962) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G110900 [exp] 171 / 2e-56 AT3G09085 147 / 2e-47 Protein of unknown function (DUF962) (.1) Potri.004G103400 [exp] 171 / 2e-56 AT3G09085 146 / 9e-47 Protein of unknown function (DUF962) (.1) Potri.006G096200 [exp] 167 / 3e-55 AT3G09085 153 / 2e-49 Protein of unknown function (DUF962) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06127 [flax] [poplar] DUF962 Protein of unknown function (DUF962)
Representative CDS sequence Show only first row Show all	>Lus10021128 pacid=23182340 polypeptide=Lus10021128 locus=Lus10021128.g ID=Lus10021128.BGIv1.0 annot-version=v1.0 ATGAATTTCAGGAGCATGGAGGAGTTCTGGGCGTTCTACATGAGCCAGCACTCGAAGCCATGGACGAGGAGGTGGCACTTCGTGGGGACGCTCCTCAGCT TGCTGACTTTACTCTACGCGCTCTGCTTCAAATTGTGGGTCCTCTCTCTGGTGCCGGTTGTCGGGTACGGGTTCGCCTGGTACAGCCACTTCTTCGTGGA GCGGAACGTGCCGGCCACTTTCGGGCACCCGGTTTGGTCCCTTGTTTGTGATTACAGGATGTTCGGATTGATGCTTACTGGGAAGATGGATAAGGAAATT AAGCGGCTTGGCAAGCGCCCTGTGTTGCAGAGCTATTGA
AA sequence Show only first row Show all	>Lus10021128 pacid=23182340 polypeptide=Lus10021128 locus=Lus10021128.g ID=Lus10021128.BGIv1.0 annot-version=v1.0 MNFRSMEEFWAFYMSQHSKPWTRRWHFVGTLLSLLTLLYALCFKLWVLSLVPVVGYGFAWYSHFFVERNVPATFGHPVWSLVCDYRMFGLMLTGKMDKEI KRLGKRPVLQSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09085			Protein of unknown function (D...		Lus10021128 [exp]	0	1
AT3G26085			CAAX amino terminal protease f...		Lus10006251 [exp]	3.5	0.8508
AT1G58210		EMB1674	EMBRYO DEFECTIVE 1674, kinase ...		Lus10032844 [exp]	5.6	0.7805
AT5G43280		ATDCI1	"delta\(3,5\),delta\(2,4\)-die...		Lus10002583 [exp]	6.5	0.8351
AT5G45820		PKS18, CIPK20, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10034212 [exp]	7.5	0.8092
AT1G21410		SKP2A	F-box/RNI-like superfamily pro...		Lus10028645 [exp]	7.9	0.8118
AT3G09085			Protein of unknown function (D...		Lus10017182 [exp]	8.7	0.8154
AT1G55000			peptidoglycan-binding LysM dom...		Lus10004477 [exp]	10.7	0.8145
AT2G27180			unknown protein		Lus10008446 [exp]	11.0	0.8061
AT2G01110		TATC, PGA2, APG...	unfertilized embryo sac 3, TWI...		Lus10007945 [exp]	12.0	0.7826
AT1G12910		LWD1, ATAN11	LIGHT-REGULATED WD 1, ANTHOCYA...		Lus10041500 [exp]	14.1	0.7952

Compare expression of checked genes

Lus10021128 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.