Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34750 97 / 7e-27 SAUR-like auxin-responsive protein family (.1.2) AT1G75590 83 / 2e-21 SAUR-like auxin-responsive protein family (.1) AT5G10990 82 / 4e-21 SAUR-like auxin-responsive protein family (.1) AT1G19840 82 / 9e-21 SAUR-like auxin-responsive protein family (.1) AT2G37030 77 / 3e-19 SAUR-like auxin-responsive protein family (.1) AT4G34760 71 / 6e-17 SAUR-like auxin-responsive protein family (.1) AT2G21220 70 / 7e-17 SAUR-like auxin-responsive protein family (.1) AT3G53250 70 / 8e-17 SAUR-like auxin-responsive protein family (.1) AT1G56150 69 / 2e-16 SAUR-like auxin-responsive protein family (.1) AT3G12830 69 / 3e-16 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017179 [exp] 216 / 3e-74 AT4G34750 89 / 6e-24 SAUR-like auxin-responsive protein family (.1.2) Lus10012426 [exp] 89 / 8e-24 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 89 / 1e-23 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 89 / 1e-23 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10026297 [exp] 70 / 2e-16 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10042374 [exp] 70 / 2e-16 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10013808 [exp] 67 / 2e-15 AT2G37030 141 / 1e-44 SAUR-like auxin-responsive protein family (.1) Lus10026521 [exp] 67 / 2e-15 AT2G37030 139 / 8e-44 SAUR-like auxin-responsive protein family (.1) Lus10012190 [exp] 67 / 3e-15 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G237000 [exp] 94 / 1e-25 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 92 / 5e-25 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 81 / 1e-20 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 81 / 2e-20 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.016G091500 [exp] 78 / 8e-20 AT2G37030 136 / 2e-42 SAUR-like auxin-responsive protein family (.1) Potri.006G126500 [exp] 74 / 3e-18 AT2G37030 131 / 1e-40 SAUR-like auxin-responsive protein family (.1) Potri.008G037900 [exp] 71 / 9e-17 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G224500 [exp] 69 / 5e-16 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.005G096400 [exp] 66 / 1e-14 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 64 / 1e-14 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10021130 pacid=23182282 polypeptide=Lus10021130 locus=Lus10021130.g ID=Lus10021130.BGIv1.0 annot-version=v1.0 ATGGCGTTCTCGGTAAAGAGTTGTTATGAATGTGGCATTTGCAAAGTGATCAAGCTGAGAAAATTTACCAACTTGTGGCAGAAGGAGGCCGGAGGAGGAG AGGAGAAGCTTCCCCGAGATGTGCCACCTGGGCATTTACCTGTCATGGTTGGGGAAGCTGGGAAAAGGTTTGTCATCAAAGCAGATCACTTGAACCATCC GATTCTCAGGAAGCTGCTAGATCAAGCATTCGAGGAGCATGGTCGTAATAACAATGGTCTCTTGGCCATACCTTGCGACGAGCCTATTTTCCGAGACATA ATCCATTCACTTACAGTCGGCGCAAAGAAACTCCGGTGTTGA
AA sequence Show only first row Show all	>Lus10021130 pacid=23182282 polypeptide=Lus10021130 locus=Lus10021130.g ID=Lus10021130.BGIv1.0 annot-version=v1.0 MAFSVKSCYECGICKVIKLRKFTNLWQKEAGGGEEKLPRDVPPGHLPVMVGEAGKRFVIKADHLNHPILRKLLDQAFEEHGRNNNGLLAIPCDEPIFRDI IHSLTVGAKKLRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34750			SAUR-like auxin-responsive pro...		Lus10021130 [exp]	0	1
					Lus10022880 [exp]	4.0	0.8134
					Lus10009774 [exp]	5.5	0.7841
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10007891 [exp]	6.9	0.7794
AT2G18960		OST2, PMA, AHA1	PLASMA MEMBRANE PROTON ATPASE,...		Lus10028202 [exp]	9.5	0.7323
AT5G53110			RING/U-box superfamily protein...		Lus10025491 [exp]	12.8	0.7659
AT2G02340		ATPP2-B8	phloem protein 2-B8 (.1)		Lus10018175 [exp]	18.0	0.7226
AT2G26250		KCS10, FDH	FIDDLEHEAD, 3-ketoacyl-CoA syn...		Lus10028105 [exp]	19.6	0.7560
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Lus10040851 [exp]	25.1	0.7554
					Lus10033601 [exp]	28.3	0.7773
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10037089 [exp]	33.1	0.7611

Compare expression of checked genes

Lus10021130 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.