Lus10021139 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006458 46 / 9e-07 ND 37 / 0.003
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021139 pacid=23182324 polypeptide=Lus10021139 locus=Lus10021139.g ID=Lus10021139.BGIv1.0 annot-version=v1.0
ATGAGGATGAGGCACGCTTGTGATGCAAAACCGGCATTCTCAGTTCGGCCAGTTTATGCTCGTGATTTCCCTTATAGCTGCATCTCTACTTCTGTTATCT
GCGGGCTTCAAATAGATATTTCGCAAGAGTGCCAATCGGCGATGATGGCCAGAGTTCATCAAACGGACATCCTTCTTGTCTCCGACTCCGGCTGCTCTTT
CCGAACAGCATTGAATCCTAAGAAGGAAGCAAATGGAAGCTACCTCCAACTGCCACAATCCCAGCTGGTACCATCCATAAGGGAGAAGGGATCATTAGAA
GAACATTGGGCGAGAAAGGTGGAATCTGTTGTAATCACTGATGCTGCAGGAGTTGATATTTCGCCTGGTACATGA
AA sequence
>Lus10021139 pacid=23182324 polypeptide=Lus10021139 locus=Lus10021139.g ID=Lus10021139.BGIv1.0 annot-version=v1.0
MRMRHACDAKPAFSVRPVYARDFPYSCISTSVICGLQIDISQECQSAMMARVHQTDILLVSDSGCSFRTALNPKKEANGSYLQLPQSQLVPSIREKGSLE
EHWARKVESVVITDAAGVDISPGT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021139 0 1
AT1G21150 Mitochondrial transcription te... Lus10039174 1.0 0.9942
AT2G36540 Haloacid dehalogenase-like hyd... Lus10016365 4.8 0.8869
AT5G46090 Protein of unknown function (D... Lus10013971 5.2 0.8490
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004530 5.7 0.9559
Lus10021851 6.9 0.9559
AT5G63810 BGAL10 beta-galactosidase 10 (.1) Lus10023974 6.9 0.8734
AT1G59840 CCB4 cofactor assembly of complex C... Lus10010732 7.5 0.8462
Lus10008791 8.0 0.9559
Lus10010327 8.4 0.8330
AT1G70830 MLP28 MLP-like protein 28 (.1.2.3.4.... Lus10012466 8.7 0.8636

Lus10021139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.