Lus10021149 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08060 156 / 3e-50 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040513 226 / 3e-78 AT5G08060 179 / 1e-59 unknown protein
Lus10034681 191 / 3e-64 AT5G08060 186 / 6e-62 unknown protein
Lus10017854 188 / 4e-63 AT5G08060 186 / 5e-62 unknown protein
Lus10017855 186 / 6e-62 ND 170 / 2e-55
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G123700 154 / 1e-49 AT5G08060 146 / 3e-46 unknown protein
PFAM info
Representative CDS sequence
>Lus10021149 pacid=23182302 polypeptide=Lus10021149 locus=Lus10021149.g ID=Lus10021149.BGIv1.0 annot-version=v1.0
ATGGCGAAATTCTCCGCCGGCAGTTTCCTGCAGATTCTCAGGCGCTACATTAAGAAGCCATGGGAGATAACGGGTCCTTGCGCCGACCCAGAATACAGGC
TGGCCATCCCCAAAGCGGTGGAGTACCGAATTGAATGCCCTGCTTCAACCAAGGTGAAGCCCATCGTCCCATCCTCCGATCCTGAAACCGTCTTCGACAT
CAAGTACCACACTCGTGATCAGCGCCGCAACCGCCCGCCGATCAAACGCACCGTATTGAAGAAGGCCAATGTGGAGAAGATGATGAAGGAGAGGACGACC
TTCCAACCATCCGATTTCCCTCCTGTTTATCTGACCCAAGCTGTGATTTCCCTCCTGTTTATCTGA
AA sequence
>Lus10021149 pacid=23182302 polypeptide=Lus10021149 locus=Lus10021149.g ID=Lus10021149.BGIv1.0 annot-version=v1.0
MAKFSAGSFLQILRRYIKKPWEITGPCADPEYRLAIPKAVEYRIECPASTKVKPIVPSSDPETVFDIKYHTRDQRRNRPPIKRTVLKKANVEKMMKERTT
FQPSDFPPVYLTQAVISLLFI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08060 unknown protein Lus10021149 0 1
AT3G55530 SDIR1 SALT- AND DROUGHT-INDUCED RING... Lus10004977 2.0 0.9454
AT5G67020 unknown protein Lus10019344 2.4 0.9474
AT5G48150 GRAS PAT1 phytochrome a signal transduct... Lus10006369 3.7 0.9071
AT3G63000 NPL41 NPL4-like protein 1 (.1) Lus10021567 4.0 0.9336
AT1G74320 Protein kinase superfamily pro... Lus10026145 4.9 0.9358
AT3G55530 SDIR1 SALT- AND DROUGHT-INDUCED RING... Lus10001568 5.9 0.9299
AT5G47120 ATBI-1, ATBI1 ARABIDOPSIS BAX INHIBITOR 1, B... Lus10000589 7.3 0.9028
AT2G40950 bZIP BZIP17 Basic-leucine zipper (bZIP) tr... Lus10027290 9.2 0.9093
AT4G30480 TPR1, AtTPR1 tetratricopeptide repeat 1, Te... Lus10035117 9.6 0.8791
AT4G15248 CO B-box type zinc finger family ... Lus10039694 10.1 0.9191

Lus10021149 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.