Plant FIBer expression Database

Lus10021160 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G74310 81 / 1e-19 HOT1, ATHSP101 heat shock protein 101 (.1)
AT4G14670 40 / 4e-05 CLPB2 casein lytic proteinase B2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040528
[exp]
96 / 6e-25 AT1G74310 1496 / 0.0 heat shock protein 101 (.1)
Lus10008970
[exp]
36 / 0.0007 AT3G52490 460 / 1e-147 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10028849
[exp]
36 / 0.0008 AT3G52490 498 / 5e-165 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G057000
[exp]
86 / 2e-21 AT1G74310 1567 / 0.0 heat shock protein 101 (.1)
Potri.015G056900
[exp]
86 / 3e-21 AT1G74310 1566 / 0.0 heat shock protein 101 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02861 Clp_N Clp amino terminal domain, pathogenicity island component
Representative CDS sequence
>Lus10021160 pacid=23182294 polypeptide=Lus10021160 locus=Lus10021160.g ID=Lus10021160.BGIv1.0 annot-version=v1.0
ATGGATCCTGGCAAGTTCACTCACAAGACAAACGAGGCCATAGCCAATGCCCATGAACTGGCATTAACCGCCGGACATGCCCAGATAACCCCTCTGCACC
TCGCTGTCGCCCTAATAACCGACCCCGCCGGAATATTCCCCCAAGCGATCGCCAATTCCGCCTCCGCCGGCGAAGCCGGCGCCCGGCGAAGCTGCGGCCC
AATCTGTGGAGAGGGTGTTTAA
AA sequence
>Lus10021160 pacid=23182294 polypeptide=Lus10021160 locus=Lus10021160.g ID=Lus10021160.BGIv1.0 annot-version=v1.0
MDPGKFTHKTNEAIANAHELALTAGHAQITPLHLAVALITDPAGIFPQAIANSASAGEAGARRSCGPICGEGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G74310 HOT1, ATHSP101 heat shock protein 101 (.1) Lus10021160
[exp]
0 1
AT1G74310 HOT1, ATHSP101 heat shock protein 101 (.1) Lus10021159
[exp]
1.7 0.9835
AT4G22580 Exostosin family protein (.1) Lus10004341
[exp]
2.0 0.9688
AT1G74310 HOT1, ATHSP101 heat shock protein 101 (.1) Lus10040528
[exp]
2.4 0.9798
AT1G74310 HOT1, ATHSP101 heat shock protein 101 (.1) Lus10040527
[exp]
3.0 0.9770
AT5G39570 unknown protein Lus10016220
[exp]
3.9 0.9535
AT4G25200 ATHSP23.6-MITO mitochondrion-localized small ... Lus10031154
[exp]
5.9 0.9429
AT1G62740 Hop2 Hop2, stress-inducible protein... Lus10028919
[exp]
6.9 0.9459
AT3G55530 SDIR1 SALT- AND DROUGHT-INDUCED RING... Lus10001568
[exp]
8.5 0.9274
AT1G74320 Protein kinase superfamily pro... Lus10026145
[exp]
11.0 0.9241
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Lus10023418
[exp]
12.3 0.9380

Lus10021160 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.