Lus10021170 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20450 218 / 1e-74 Ribosomal protein L14 (.1)
AT4G27090 216 / 7e-74 Ribosomal protein L14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011807 261 / 1e-91 AT2G20450 221 / 9e-76 Ribosomal protein L14 (.1)
Lus10024918 251 / 8e-88 AT2G20450 224 / 3e-77 Ribosomal protein L14 (.1)
Lus10008246 250 / 2e-87 AT2G20450 228 / 8e-79 Ribosomal protein L14 (.1)
Lus10003627 154 / 6e-50 AT4G27090 139 / 2e-44 Ribosomal protein L14 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G168600 232 / 3e-80 AT4G27090 230 / 2e-79 Ribosomal protein L14 (.1)
Potri.002G035700 229 / 5e-79 AT4G27090 234 / 8e-81 Ribosomal protein L14 (.1)
Potri.005G227300 228 / 9e-79 AT4G27090 235 / 3e-81 Ribosomal protein L14 (.1)
Potri.010G069900 226 / 7e-78 AT4G27090 228 / 2e-78 Ribosomal protein L14 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01929 Ribosomal_L14e Ribosomal protein L14
Representative CDS sequence
>Lus10021170 pacid=23171383 polypeptide=Lus10021170 locus=Lus10021170.g ID=Lus10021170.BGIv1.0 annot-version=v1.0
ATGGGTTTCAAAAGATACGTCGAGATCGGACGGGTTGCTCTGATCAACTACGGGAAGGACTATGGAAAGCTCGTTGTCATTGTCGATGTCGTCGACCAAA
ATCGGGCTCTAGTTGATTCACCTGATATGGTTAGGAGCCAAATCAATTTCAAGAGGCTTACTCTCACTGACATCAAGATTGAGATTAACAGAGTTCCCAG
GAAGAAGACTCTTATCGAAGCCATGGAGAAGGCTGATGTTAAAGGAAAGTGGGAGAACAGCTCTTGGGGCTGCAAGTTGATCGTTAAGCAGAGGAGGGCA
GCTCTCACCGACTTTGACAGGTTCAAGGTTATGTTGGCAAAGATCAAGAGAGGAGGATTGATCAAGCAAGAGCTTGCCAAGCTGAAGAAGACCGCCGCTT
AG
AA sequence
>Lus10021170 pacid=23171383 polypeptide=Lus10021170 locus=Lus10021170.g ID=Lus10021170.BGIv1.0 annot-version=v1.0
MGFKRYVEIGRVALINYGKDYGKLVVIVDVVDQNRALVDSPDMVRSQINFKRLTLTDIKIEINRVPRKKTLIEAMEKADVKGKWENSSWGCKLIVKQRRA
ALTDFDRFKVMLAKIKRGGLIKQELAKLKKTAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20450 Ribosomal protein L14 (.1) Lus10021170 0 1
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10014035 1.0 0.9695
AT3G25520 PGY3, ATL5, OLI... RIBOSOMAL PROTEIN L5 A, PIGGYB... Lus10004874 1.4 0.9686
AT1G41880 Ribosomal protein L35Ae family... Lus10028254 1.7 0.9678
AT5G02610 Ribosomal L29 family protein ... Lus10023449 2.0 0.9652
AT4G39200 Ribosomal protein S25 family p... Lus10021706 5.5 0.9507
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10027260 6.9 0.9550
AT4G14320 Zinc-binding ribosomal protein... Lus10010195 7.0 0.9536
AT5G02610 Ribosomal L29 family protein ... Lus10019179 8.5 0.9514
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10000421 8.7 0.9398
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023454 8.9 0.9587

Lus10021170 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.