Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04410 107 / 1e-29 c-NAD-MDH1 cytosolic-NAD-dependent malate dehydrogenase 1, Lactate/malate dehydrogenase family protein (.1) AT5G43330 103 / 2e-28 c-NAD-MDH2 cytosolic-NAD-dependent malate dehydrogenase 2, Lactate/malate dehydrogenase family protein (.1) AT5G56720 85 / 3e-21 c-NAD-MDH3 cytosolic-NAD-dependent malate dehydrogenase 3, Lactate/malate dehydrogenase family protein (.1) AT5G58330 42 / 7e-06 lactate/malate dehydrogenase family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011819 [exp] 110 / 1e-30 AT5G43330 613 / 0.0 cytosolic-NAD-dependent malate dehydrogenase 2, Lactate/malate dehydrogenase family protein (.1) Lus10021870 [exp] 109 / 1e-30 AT5G43330 606 / 0.0 cytosolic-NAD-dependent malate dehydrogenase 2, Lactate/malate dehydrogenase family protein (.1) Lus10041144 [exp] 99 / 1e-25 AT5G43330 590 / 0.0 cytosolic-NAD-dependent malate dehydrogenase 2, Lactate/malate dehydrogenase family protein (.1) Lus10037935 [exp] 40 / 4e-05 AT5G58330 709 / 0.0 lactate/malate dehydrogenase family protein (.1.2.3) Lus10038668 [exp] 40 / 4e-05 AT5G58330 707 / 0.0 lactate/malate dehydrogenase family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G071000 [exp] 108 / 6e-30 AT5G43330 602 / 0.0 cytosolic-NAD-dependent malate dehydrogenase 2, Lactate/malate dehydrogenase family protein (.1) Potri.008G166800 [exp] 106 / 2e-29 AT5G43330 605 / 0.0 cytosolic-NAD-dependent malate dehydrogenase 2, Lactate/malate dehydrogenase family protein (.1) Potri.002G141700 [exp] 97 / 1e-25 AT1G04410 572 / 0.0 cytosolic-NAD-dependent malate dehydrogenase 1, Lactate/malate dehydrogenase family protein (.1) Potri.002G141900 [exp] 97 / 1e-25 AT1G04410 501 / 5e-180 cytosolic-NAD-dependent malate dehydrogenase 1, Lactate/malate dehydrogenase family protein (.1) Potri.008G031700 [exp] 42 / 1e-05 AT5G58330 710 / 0.0 lactate/malate dehydrogenase family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00056 [flax] [poplar] Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
Representative CDS sequence Show only first row Show all	>Lus10021183 pacid=23171378 polypeptide=Lus10021183 locus=Lus10021183.g ID=Lus10021183.BGIv1.0 annot-version=v1.0 ATGGCGAAGGATCTAGCTCGCATTCTCGTCACCGAAGCTGCAGGACAAATTGGATATGCTCTTGCTCCCATGATTGCTAGGGGAGTGATGCTTGGTGCTG ACCAGCCAGTCATCCTCCACATGCTTGATATCCCACCTGCAGCTGAGGCTTTGAATGGTGTCAAGATGGAGTTGGTTGATGCTGCGTTCTCTCTTCTTAA AGGTTTCTCCAGTTCTTTACTAGCTCTCTTTGGGATTTCTGTTGGATGA
AA sequence Show only first row Show all	>Lus10021183 pacid=23171378 polypeptide=Lus10021183 locus=Lus10021183.g ID=Lus10021183.BGIv1.0 annot-version=v1.0 MAKDLARILVTEAAGQIGYALAPMIARGVMLGADQPVILHMLDIPPAAEALNGVKMELVDAAFSLLKGFSSSLLALFGISVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04410		c-NAD-MDH1	cytosolic-NAD-dependent malate...		Lus10021183 [exp]	0	1
AT2G45200		ATGOS12, GOS12	golgi snare 12 (.1.2)		Lus10015880 [exp]	3.5	1.0000
					Lus10016593 [exp]	6.3	1.0000
AT3G49210			O-acyltransferase (WSD1-like) ...		Lus10022417 [exp]	7.3	1.0000
AT4G33910			2-oxoglutarate (2OG) and Fe(II...		Lus10020969 [exp]	14.7	1.0000
AT5G13620			unknown protein		Lus10017168 [exp]	14.8	1.0000
AT1G64720		CP5	Polyketide cyclase/dehydrase a...		Lus10015566 [exp]	14.9	1.0000
					Lus10017783 [exp]	16.2	1.0000
AT5G12180		CPK17	calcium-dependent protein kina...		Lus10000889 [exp]	16.9	1.0000
					Lus10018798 [exp]	18.2	1.0000
					Lus10003843 [exp]	18.8	1.0000

Compare expression of checked genes

Lus10021183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.