Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028108 [exp] 37 / 0.0004 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021186 pacid=23171398 polypeptide=Lus10021186 locus=Lus10021186.g ID=Lus10021186.BGIv1.0 annot-version=v1.0 ATGGTCGGGGAGTTAGATCTAGAGTTGGATGGCGGCGAAAACCCTCCAGATAGAGAAGACCCAACCGTCCTCGACGAAAAGAGAATCGGCCATCGCCGCC GTACAGGAAAGAAGACGGTGGGAAAGGAGAAAGAAAAGATCCCACCTGATGACATGAAAGCAGGAGGATGTTGGTGTTTTGGGGAGGGGGGAATGACAGT GCAAACAAGGTGCAGTCTAGCTAGGGTTCAGACAATCGTACGAGGAAAGGATGTACCGCATGGAGTTTGA
AA sequence Show only first row Show all	>Lus10021186 pacid=23171398 polypeptide=Lus10021186 locus=Lus10021186.g ID=Lus10021186.BGIv1.0 annot-version=v1.0 MVGELDLELDGGENPPDREDPTVLDEKRIGHRRRTGKKTVGKEKEKIPPDDMKAGGCWCFGEGGMTVQTRCSLARVQTIVRGKDVPHGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021186 [exp]	0	1
AT1G05710	bHLH	bHLH153	basic helix-loop-helix (bHLH) ...		Lus10025599 [exp]	2.4	0.7802
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10022081 [exp]	5.8	0.7150
AT2G46580			Pyridoxamine 5'-phosphate oxid...		Lus10030234 [exp]	7.5	0.7423
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Lus10021185 [exp]	11.7	0.7594
AT5G61310			Cytochrome c oxidase subunit V...		Lus10001454 [exp]	13.4	0.7558
AT3G22040			Domain of unknown function (DU...		Lus10007504 [exp]	16.1	0.6839
AT3G28345		MDR13, ABCB15	multi-drug resistance 13, ATP-...		Lus10024162 [exp]	16.9	0.7632
AT5G64360		EIP9	EMF1-Interacting Protein 1, Ch...		Lus10002650 [exp]	17.3	0.6742
AT3G45640		ATMAPK3, ATMPK3	mitogen-activated protein kina...		Lus10036136 [exp]	19.3	0.7576
AT1G05710	bHLH	bHLH153	basic helix-loop-helix (bHLH) ...		Lus10027064 [exp]	22.3	0.7493

Compare expression of checked genes

Lus10021186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.