Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011822 [exp] 219 / 6e-69 AT1G04400 781 / 0.0 cryptochrome 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G071200 [exp] 91 / 2e-22 AT1G04400 799 / 0.0 cryptochrome 2 (.1.2) Potri.008G166566 [exp] 79 / 2e-19 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021189 pacid=23171402 polypeptide=Lus10021189 locus=Lus10021189.g ID=Lus10021189.BGIv1.0 annot-version=v1.0 ATGAGGGAGAAATCCAAAGCTGCTTGTCCTAGTATTTCATCTAATGATCAGAAGGTGCCATCATTTCACAGTATGAAGAAGGATCTAGTCAGTAAGAAGA GATCGAAATGCATGGAGGGGGATAAGCAGCAACATTGTAACGATGGAGTAGGGACTTCAAGAGGAGACATAGAATTGTACTCCACTGCAGAATCTTCAGC GGCCAAAAAGCAGGCAACAACGGGCAGATGTTCATTTTCTGTTCCACAGTATAGTTCGTCGTCAGAAGGCAACAGCACAGCTCAGGAATGTGAACAATCA GAGGGATGTGAATTGCAAATTGACTTGGAAAAAAGTCCAGCCAAAGATGTTGCCATGGGATCTTGA
AA sequence Show only first row Show all	>Lus10021189 pacid=23171402 polypeptide=Lus10021189 locus=Lus10021189.g ID=Lus10021189.BGIv1.0 annot-version=v1.0 MREKSKAACPSISSNDQKVPSFHSMKKDLVSKKRSKCMEGDKQQHCNDGVGTSRGDIELYSTAESSAAKKQATTGRCSFSVPQYSSSSEGNSTAQECEQS EGCELQIDLEKSPAKDVAMGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021189 [exp]	0	1
AT1G21200	Trihelix		sequence-specific DNA binding ...		Lus10028581 [exp]	1.4	0.9182
AT1G55340			Protein of unknown function (D...		Lus10013616 [exp]	2.4	0.8948
AT1G21200	Trihelix		sequence-specific DNA binding ...		Lus10018886 [exp]	7.3	0.9039
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10019530 [exp]	7.9	0.8766
AT3G12550		FDM3	factor of DNA methylation 3, X...		Lus10000948 [exp]	10.2	0.8994
AT1G64385			unknown protein		Lus10033958 [exp]	11.0	0.8882
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10040543 [exp]	11.8	0.8775
AT2G25950			Protein of unknown function (D...		Lus10007454 [exp]	13.4	0.9065
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008023 [exp]	13.6	0.8611
AT4G27040		VPS22	EAP30/Vps36 family protein (.1...		Lus10002292 [exp]	14.3	0.8435

Compare expression of checked genes

Lus10021189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.