Gene [FLAX] | FIBexDB

Lus10021194 [FLAX]

External link

JGI Phytozome v13

[genome browser]

Symbol

Arabidopsis homologues

Show only best Show top 10

No hit found

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10033023 [exp]	268 / 2e-90	AT2G26695	202 / 4e-65	Ran BP2/NZF zinc finger-like superfamily protein (.1)
Lus10024456 [exp]	255 / 7e-81	AT5G49880	508 / 2e-170	mitotic checkpoint family protein (.1)
Lus10012671 [exp]	219 / 6e-73	ND	/
Lus10005469 [exp]	217 / 2e-72	ND	/
Lus10005288 [exp]	145 / 4e-43	ND	/
Lus10005726 [exp]	142 / 5e-39	AT5G51200	2356 / 0.0	EMBRYO DEFECTIVE 3142, Protein of unknown function (DUF3414) (.1)
Lus10004769 [exp]	102 / 1e-26	ND	/
Lus10005823 [exp]	64 / 8e-13	ND	/
Lus10038594 [exp]	58 / 2e-10	ND	/

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10021194 pacid=23171361 polypeptide=Lus10021194 locus=Lus10021194.g ID=Lus10021194.BGIv1.0 annot-version=v1.0

ATGCTGATGTTGACCAGTCAAGGCCGTGTCACGGCCGTGATGGGGAACCTGTTATTCCGCAACAATTGGATGATCCAAAACCCGAATAAGAATGAGTATG

ATTGTGGTTATGGTGATTTCACCAATGGGAATTTGAATGATCAAGGCTATTCAAATTGGCAAGACCAATCTAGCTTTCATGGTGATTCACAATTTGGAAA

CTCGATGAATGGGAATTATGGTCCCTCCACTTCCAATGAAGATACTGTTAAGCTAATCCAAGACATTGAAGCTCGCTATCATGCCGATATAGCTATTCAA

GTGGCTCACAATGCAAGGATTGAATCAACTTTGGGAGAGCTTCAAGAGTCCATCAATGTCATAGCTTTCCAACTCAAAGAAGAAAGAAATAGTCACCGAG

CATCTCAACAAGAAACTAGCTCTTCACGCTCTATCATGAAAACAAAAAGCGTTGAGAAGTTGTTAAGTGACTTTACAAGACAACTTGGGGCTAGATTGGT

AAAACAAGAAGACAAGATTGATCGCTTGTTAAGTAAAATGGAAATCCTCCAAGATGCTTTCTTTGAATTGGAATACAAGACTCGAGCTTGGCATACTAAC

ATTTGA

AA sequence

Show only first row Show all

>Lus10021194 pacid=23171361 polypeptide=Lus10021194 locus=Lus10021194.g ID=Lus10021194.BGIv1.0 annot-version=v1.0

MLMLTSQGRVTAVMGNLLFRNNWMIQNPNKNEYDCGYGDFTNGNLNDQGYSNWQDQSSFHGDSQFGNSMNGNYGPSTSNEDTVKLIQDIEARYHADIAIQ

VAHNARIESTLGELQESINVIAFQLKEERNSHRASQQETSSSRSIMKTKSVEKLLSDFTRQLGARLVKQEDKIDRLLSKMEILQDAFFELEYKTRAWHTN

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021194 [exp]	0	1

Lus10021194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.