Lus10021204 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59530 184 / 4e-56 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06620 181 / 1e-54 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 172 / 4e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G04380 170 / 9e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43440 169 / 3e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G43450 169 / 4e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840 165 / 1e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04350 165 / 1e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650 162 / 2e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06640 161 / 6e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022197 263 / 9e-87 AT1G06620 434 / 6e-153 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10041230 191 / 3e-60 AT5G59530 270 / 1e-90 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021203 194 / 7e-60 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 194 / 9e-60 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 194 / 1e-59 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10017080 191 / 2e-58 AT1G06620 440 / 3e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037796 189 / 1e-57 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 187 / 4e-57 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 185 / 3e-56 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073232 201 / 1e-62 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 195 / 5e-60 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073166 191 / 1e-58 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 173 / 9e-52 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.008G165400 171 / 5e-51 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.013G045000 170 / 2e-50 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 169 / 3e-50 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.017G135800 140 / 7e-39 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G136000 136 / 1e-37 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 133 / 2e-36 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10021204 pacid=23171373 polypeptide=Lus10021204 locus=Lus10021204.g ID=Lus10021204.BGIv1.0 annot-version=v1.0
ATGGCTCCGCATCCTCCTCAACCTCATGAATTGCCCGCTTGCTGCAGGGATATCTTGATCAGTTACTCTAGCGAAATGCTGAAATTGGGTGATCTACTCT
TGGAACTGTTGTCTGAGGCTCTAGGTTTAACCCCAAATCATTTGAAAGAAATGGATTGTTCAAATGGGCTATGTGTATTGTGCCATTACCATCCACCTTG
TCCTCAACCAGAGCTCACTCTGGGTTCATCCAAGCATCAAGATGATGATTTCATAACAGTGCTTATACAAGATGACATCGGAGGCCTTCAAGTTCTTCAC
CTGGATCAATGGGTTGATGTACCTCCCTTGCCAGGGAGTCTGGTGGTCAACATTGGAGACTTGCTTCAGCTTCTGTCGAATGACAAGTTCATAAGCGCCG
AGCATCGTGCTCTGGTTAAAAGCAAAGGACCTCGAGTCTCAGTGGGTCATTTTTCACTCATGGGTTTTCACCCAATCCTCGAATGTATGGGCCTATCAAG
GAGCTCTTGTCAGAAGACAATCCGCCAAAGTACAGGGAAGTCTCAATTCAGGAGTTTACTTCCCACATATATGATAACGGCCTCGGCGGAGCTTCTGCTC
TGCATCGTCTTAAGTTATGAATATTTGAATTTTGCCGTGGAATCGTACGTTTTAAGCCATCACCATGAGATTGTCGAACCAACTGATGCTTTCGACCTAA
CCAAAGCCGGAGTGAAAGGGCTTCTGGATTCTGGAATCACTGAGCTCCCTCGTATCTTTCATGCCCCGCATCATCTCCTCCATGACAGACCAGTCGCTCC
AACCGACGATCCCAACTTCATTTTGCCAATCATAGACCTGGAAGGGTGA
AA sequence
>Lus10021204 pacid=23171373 polypeptide=Lus10021204 locus=Lus10021204.g ID=Lus10021204.BGIv1.0 annot-version=v1.0
MAPHPPQPHELPACCRDILISYSSEMLKLGDLLLELLSEALGLTPNHLKEMDCSNGLCVLCHYHPPCPQPELTLGSSKHQDDDFITVLIQDDIGGLQVLH
LDQWVDVPPLPGSLVVNIGDLLQLLSNDKFISAEHRALVKSKGPRVSVGHFSLMGFHPILECMGLSRSSCQKTIRQSTGKSQFRSLLPTYMITASAELLL
CIVLSYEYLNFAVESYVLSHHHEIVEPTDAFDLTKAGVKGLLDSGITELPRIFHAPHHLLHDRPVAPTDDPNFILPIIDLEG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59530 2-oxoglutarate (2OG) and Fe(II... Lus10021204 0 1
AT4G00950 MEE47 maternal effect embryo arrest ... Lus10030238 6.7 0.6716
AT3G16360 AHP4 HPT phosphotransmitter 4 (.1.2... Lus10035596 11.9 0.6348
AT5G18420 unknown protein Lus10027578 41.5 0.6176
AT4G02485 2-oxoglutarate (2OG) and Fe(II... Lus10037635 55.5 0.6159
AT1G53490 RING/U-box superfamily protein... Lus10005260 56.8 0.5780
AT3G57080 RPB5B, NRPE5 RNA POLYMERASE II FIFTH LARGES... Lus10042019 78.7 0.5306
AT1G08230 ATGAT1 L-GAMMA-AMINOBUTYRIC ACID TRAN... Lus10037913 99.8 0.5604
AT5G61220 LYR family of Fe/S cluster bio... Lus10003467 101.2 0.5674
AT1G03430 AHP5 histidine-containing phosphotr... Lus10003256 104.4 0.5615
AT2G04740 ankyrin repeat family protein ... Lus10012362 124.7 0.5567

Lus10021204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.