Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14450 75 / 1e-18 ATBET12 unknown protein AT1G04330 73 / 4e-18 unknown protein AT3G23170 61 / 2e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022200 [exp] 189 / 2e-63 AT4G14450 78 / 1e-19 unknown protein Lus10041157 [exp] 129 / 5e-40 AT4G14450 72 / 3e-17 unknown protein Lus10021878 [exp] 127 / 2e-39 AT4G14450 71 / 6e-17 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G164801 [exp] 122 / 3e-37 AT4G14450 57 / 1e-11 unknown protein Potri.010G073900 [exp] 112 / 1e-33 AT4G14450 56 / 3e-11 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021208 pacid=23171382 polypeptide=Lus10021208 locus=Lus10021208.g ID=Lus10021208.BGIv1.0 annot-version=v1.0 ATGGCAGACAAGCCGAGGAACGGAAGTAGTAAGATCTCCTCCACTTCCACCCCGGCCGCGGGGCAGTCGAGCCGTCTCCAACGGCGAAGACCGGCGTCCT TGCAGATAAATCCGGTGTCGTCTTCCTTCTGGAACGCGGCCATCCCTCTTCTCTCTCCTCTCGAAACCTCCCCCACAGCAATCGATGGAAAGGAGCAGCA ACAGCAACAGCAGATTCAGAATCAGAAGCGAGGAGGCGGAGGGGAGGCAGATAAGCCAATCGTGTTCAAGAAGTGGCAGCATCCTGCTGCGCCCTTCTGC TACGAGCCGGAGAAATTTAAGCCCTCCTTCTTCGTCCCCGTATAG
AA sequence Show only first row Show all	>Lus10021208 pacid=23171382 polypeptide=Lus10021208 locus=Lus10021208.g ID=Lus10021208.BGIv1.0 annot-version=v1.0 MADKPRNGSSKISSTSTPAAGQSSRLQRRRPASLQINPVSSSFWNAAIPLLSPLETSPTAIDGKEQQQQQQIQNQKRGGGGEADKPIVFKKWQHPAAPFC YEPEKFKPSFFVPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14450		ATBET12	unknown protein		Lus10021208 [exp]	0	1
AT5G17350			unknown protein		Lus10034636 [exp]	1.7	0.9112
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10023213 [exp]	3.2	0.8990
AT4G25380		AtSAP10, SAP10	Arabidopsis thaliana stress-as...		Lus10038901 [exp]	3.5	0.8444
AT1G49780		PUB26	plant U-box 26 (.1)		Lus10014073 [exp]	6.2	0.8441
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10012224 [exp]	7.0	0.8639
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10008893 [exp]	7.3	0.8862
AT3G48240			Octicosapeptide/Phox/Bem1p fam...		Lus10019490 [exp]	8.9	0.8320
					Lus10018622 [exp]	9.4	0.8613
AT1G08250		AtADT6, ADT6	Arabidopsis thaliana arogenate...		Lus10019526 [exp]	10.0	0.8722
AT1G08250		AtADT6, ADT6	Arabidopsis thaliana arogenate...		Lus10043369 [exp]	10.7	0.8640

Compare expression of checked genes

Lus10021208 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.