Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003298 [exp] 56 / 9e-11 AT1G52950 48 / 7e-06 Nucleic acid-binding, OB-fold-like protein (.1) Lus10022056 [exp] 50 / 3e-09 ND 36 / 0.002 Lus10022054 [exp] 50 / 3e-09 ND 36 / 0.002 Lus10036312 [exp] 50 / 1e-08 AT5G08020 67 / 3e-11 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1) Lus10042979 [exp] 40 / 3e-05 AT5G08020 54 / 5e-07 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1) Lus10023787 [exp] 40 / 5e-05 ND 44 / 3e-04 Lus10038483 [exp] 37 / 6e-05 ND / Lus10006887 [exp] 39 / 0.0001 AT4G19130 63 / 7e-10 Replication factor-A protein 1-related (.1) Lus10007781 [exp] 37 / 0.0004 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021217 pacid=23171363 polypeptide=Lus10021217 locus=Lus10021217.g ID=Lus10021217.BGIv1.0 annot-version=v1.0 ATGGCTCCTATTTCGCTCTCAAACTTGGGTGATGATGCAAAGTATGTTACCCTCCGCCTTCGCTTGCTCAACAGTTGGAAGGCTGGCAATCCAACGACGT CTGATCCATGTTTTGCCTACCCAACTCCGTGGACGGATCAGCCGGGTGCTCGCATCGAAGGCACTTCAGCTCCCGTGCACGTTGATGCTCTAGCCTCGCA GCTCAGACACTGTGAGAAGTAG
AA sequence Show only first row Show all	>Lus10021217 pacid=23171363 polypeptide=Lus10021217 locus=Lus10021217.g ID=Lus10021217.BGIv1.0 annot-version=v1.0 MAPISLSNLGDDAKYVTLRLRLLNSWKAGNPTTSDPCFAYPTPWTDQPGARIEGTSAPVHVDALASQLRHCEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021217 [exp]	0	1
AT5G01150			Protein of unknown function (D...		Lus10003168 [exp]	1.4	0.9982
AT5G45980	HD	WOX9B, STPL, WO...	WUSCHEL related homeobox 9B, S...		Lus10013960 [exp]	2.0	0.9982
AT2G17950	HD	WUS1, PGA6, WUS	WUSCHEL 1, WUSCHEL, Homeodomai...		Lus10041909 [exp]	3.9	0.9954
AT1G76420	NAC	NAC368, CUC3, A...	CUP SHAPED COTYLEDON3, Arabido...		Lus10013205 [exp]	4.5	0.9934
AT4G12910		SCPL20	serine carboxypeptidase-like 2...		Lus10020206 [exp]	4.7	0.9819
AT1G55580	GRAS	SCL18, LAS	SCARECROW-LIKE 18, Lateral Sup...		Lus10032882 [exp]	4.7	0.9890
AT1G54215			proline-rich family protein (....		Lus10037669 [exp]	6.0	0.9923
AT1G73620			Pathogenesis-related thaumatin...		Lus10031346 [exp]	6.0	0.9914
AT2G35160		SGD9, SUVH5	SET DOMAIN-CONTAINING PROTEIN ...		Lus10043211 [exp]	6.3	0.9924
					Lus10026293 [exp]	7.5	0.9923

Compare expression of checked genes

Lus10021217 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.