Lus10021225 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06750 54 / 3e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT2G30630 52 / 9e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT1G04280 45 / 3e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021884 70 / 6e-14 AT2G30630 224 / 2e-69 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10041167 67 / 8e-13 AT2G30630 524 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10033855 59 / 7e-10 AT2G30630 804 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10014744 59 / 9e-10 AT2G30630 793 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G043000 56 / 6e-09 AT1G06750 777 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.005G220000 53 / 7e-08 AT1G06750 803 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.008G162000 48 / 3e-06 AT1G04280 549 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.008G162400 42 / 0.0004 AT1G04280 491 / 4e-170 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10021225 pacid=23171390 polypeptide=Lus10021225 locus=Lus10021225.g ID=Lus10021225.BGIv1.0 annot-version=v1.0
ATGTACAACGATAGTGGCGGAGCTGACCTCAAGGATCGTGCAAAATCGCTGTGCTCGCAGCTTGTGGAGGAGCTGGAGAGGTGCATTTTAAGCTACCTCG
CCTTCCACTGGAACCACGCCGCTTCTCTCGTAACTCAGGTGATAAACGAAGAGTCGTCGGAAAAGAAGGGGAAGCTGAAAAGCATGGTAATGGCTGCCAC
CAGCGTTACCGGAGAGGGAGACCTTCTCCATGAACCACTAATAACTCCGAACTACCACTCCTATGATATTGGAACCCCTTCATTGCTGACCAAAGCTGGT
TACTTTGACATAGAGGAATGGACTTTACCCACCTTTTCAGAAACTGTCGATTGGAAATTGGAGATATTAAATCCCCCCAAACCCCTGAGTTATGACCCTG
GCATCACCGTACCCAAGGTGGATTTTTCTCCCCAACCAGTCAAATCGGAGATAGAACGCCTTTACTCTCCACTGAGTGACCGTACTGGTGACAAGAGCAC
CTCTCAGTCTACAAATTTTCAACTCCTAGATAAGTGGAGCCATAACTCACTGAGCAGAGACATCCCCTCTATCGGAGGAATCATTAACACGTCTCTGACT
GTTGAAGCTAGTGACCTCTATTCAAGGGAAGATCATGACCTCAGCTCCGGTAAAACACATCCCATCTATCACTCGACACTGAATCCCCCCAGCATCTCCT
CCCAAGAATAA
AA sequence
>Lus10021225 pacid=23171390 polypeptide=Lus10021225 locus=Lus10021225.g ID=Lus10021225.BGIv1.0 annot-version=v1.0
MYNDSGGADLKDRAKSLCSQLVEELERCILSYLAFHWNHAASLVTQVINEESSEKKGKLKSMVMAATSVTGEGDLLHEPLITPNYHSYDIGTPSLLTKAG
YFDIEEWTLPTFSETVDWKLEILNPPKPLSYDPGITVPKVDFSPQPVKSEIERLYSPLSDRTGDKSTSQSTNFQLLDKWSHNSLSRDIPSIGGIINTSLT
VEASDLYSREDHDLSSGKTHPIYHSTLNPPSISSQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06750 P-loop containing nucleoside t... Lus10021225 0 1
AT1G04280 P-loop containing nucleoside t... Lus10021226 9.1 0.8201
AT5G41790 CIP1 COP1-interactive protein 1 (.1... Lus10032362 9.5 0.7297
AT5G49950 alpha/beta-Hydrolases superfam... Lus10037325 11.7 0.7772
AT2G41705 camphor resistance CrcB family... Lus10028072 13.2 0.7697
AT1G34770 unknown protein Lus10033452 15.4 0.7442
AT1G20050 HYD1 HYDRA1, C-8,7 sterol isomerase... Lus10032965 16.3 0.7518
AT4G30900 DNAse I-like superfamily prote... Lus10036263 16.4 0.7334
AT1G21980 ATPIPK1, ATPIP5... phosphatidylinositol-4-phospha... Lus10029661 18.5 0.6919
AT3G16857 GARP ARR1 response regulator 1 (.1.2) Lus10016846 33.4 0.6804
AT5G56580 ANQ1, ATMKK6 ARABIDOPSIS THALIANA MAP KINAS... Lus10034986 35.2 0.7450

Lus10021225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.