Plant FIBer expression Database

Lus10021233 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G40190 51 / 6e-09 LEW3 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007500
[exp]
64 / 2e-13 AT2G40190 745 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Lus10028977
[exp]
61 / 2e-12 AT2G40190 751 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Lus10007909
[exp]
55 / 3e-11 AT2G40190 152 / 3e-45 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Lus10014773
[exp]
54 / 7e-10 AT2G40190 188 / 1e-55 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Lus10007501
[exp]
49 / 1e-08 AT2G40190 103 / 2e-26 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G095500
[exp]
53 / 1e-09 AT2G40190 735 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10021233 pacid=23178206 polypeptide=Lus10021233 locus=Lus10021233.g ID=Lus10021233.BGIv1.0 annot-version=v1.0
ATGATGGAGGCGACGGCTAATTCATCATGGTGCGCAGTCAAAGCCATTCAGGAAGAAATCCCTGATCTCGATTACATCATCTACACCGGCTATCACAAAA
CATCTCCTCAGTCCCTCTTCGCTGTGCCACCGACCGATTCAGCGTCAGATTGCTCCGTCCGCCGAAGGCGGTCCACCTTCACCGAAGGAAATGGGCGGAG
AAGTCCAACTTATCCTCGATTCACTATGATCTGA
AA sequence
>Lus10021233 pacid=23178206 polypeptide=Lus10021233 locus=Lus10021233.g ID=Lus10021233.BGIv1.0 annot-version=v1.0
MMEATANSSWCAVKAIQEEIPDLDYIIYTGYHKTSPQSLFAVPPTDSASDCSVRRRRSTFTEGNGRRSPTYPRFTMI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10021233
[exp]
0 1
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10040226
[exp]
1.0 0.9757
AT5G65165 SDH2-3 succinate dehydrogenase 2-3 (.... Lus10028289
[exp]
1.7 0.9559
Lus10034979
[exp]
2.0 0.9618
AT4G23310 CRK23 cysteine-rich RLK (RECEPTOR-li... Lus10023335
[exp]
2.8 0.9518
AT5G46090 Protein of unknown function (D... Lus10013933
[exp]
3.9 0.9313
AT4G28380 Leucine-rich repeat (LRR) fami... Lus10017713
[exp]
4.9 0.9242
AT5G59340 HD WOX2 WUSCHEL related homeobox 2 (.1... Lus10040840
[exp]
5.2 0.9107
AT1G77450 NAC ANAC032 NAC domain containing protein ... Lus10031937
[exp]
5.5 0.8951
AT1G56140 Leucine-rich repeat transmembr... Lus10031777
[exp]
6.5 0.9221
AT2G21910 CYP96A5 "cytochrome P450, family 96, s... Lus10018158
[exp]
6.8 0.8849

Lus10021233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.