Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31812 132 / 1e-41 ACBP6, ACBP acyl-CoA-binding protein 6 (.1) AT5G53470 59 / 2e-11 ACBP1 acyl-CoA binding protein 1 (.1) AT4G27780 53 / 3e-09 ACBP2 acyl-CoA binding protein 2 (.1) AT5G27630 49 / 8e-08 ACBP5 acyl-CoA binding protein 5 (.1) AT3G05420 49 / 1e-07 ACBP4 acyl-CoA binding protein 4 (.1.2) AT4G24230 44 / 8e-06 ACBP3 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013605 [exp] 176 / 1e-58 AT1G31812 132 / 1e-41 acyl-CoA-binding protein 6 (.1) Lus10029352 [exp] 138 / 8e-44 AT1G31812 110 / 2e-33 acyl-CoA-binding protein 6 (.1) Lus10005910 [exp] 53 / 4e-09 AT4G27780 430 / 3e-151 acyl-CoA binding protein 2 (.1) Lus10004499 [exp] 52 / 6e-09 AT3G05420 1019 / 0.0 acyl-CoA binding protein 4 (.1.2) Lus10022382 [exp] 52 / 6e-09 AT4G27780 432 / 2e-152 acyl-CoA binding protein 2 (.1) Lus10029902 [exp] 51 / 2e-08 AT3G05420 1040 / 0.0 acyl-CoA binding protein 4 (.1.2) Lus10031497 [exp] 50 / 6e-08 AT3G05420 1027 / 0.0 acyl-CoA binding protein 4 (.1.2) Lus10015176 [exp] 50 / 7e-08 AT3G05420 1024 / 0.0 acyl-CoA binding protein 4 (.1.2) Lus10018702 [exp] 42 / 4e-05 AT5G67360 607 / 0.0 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G103700 [exp] 157 / 2e-51 AT1G31812 138 / 2e-44 acyl-CoA-binding protein 6 (.1) Potri.001G130200 [exp] 155 / 7e-51 AT1G31812 140 / 4e-45 acyl-CoA-binding protein 6 (.1) Potri.005G026900 [exp] 54 / 1e-09 AT3G05420 1005 / 0.0 acyl-CoA binding protein 4 (.1.2) Potri.015G010200 [exp] 50 / 2e-08 AT4G27780 432 / 3e-152 acyl-CoA binding protein 2 (.1) Potri.013G018800 [exp] 50 / 4e-08 AT3G05420 999 / 0.0 acyl-CoA binding protein 4 (.1.2) Potri.012G017700 [exp] 49 / 8e-08 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1) Potri.014G018700 [exp] 43 / 1e-05 AT4G24230 133 / 2e-35 acyl-CoA-binding domain 3 (.1.2.3.4.5.6) Potri.002G120200 [exp] 41 / 4e-05 AT4G24230 113 / 3e-28 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0632 [flax] [poplar] FERM_M PF00887 [flax] [poplar] ACBP Acyl CoA binding protein
Representative CDS sequence Show only first row Show all	>Lus10021246 pacid=23178164 polypeptide=Lus10021246 locus=Lus10021246.g ID=Lus10021246.BGIv1.0 annot-version=v1.0 ATGGGTTTGAAGATCCCTGCTTTGACACAATTCAAGATCTGGGCTCAGTTGTTCGAGTTGGCTTCTTTTCCAGTTGCCAATGCTAAGGAGGACTTTGAGG AGCATGCCCAGAAGGCAATGACCTTGCCTGAGAGCACTACGAATGAGAACAAGCTCATTCTGTATGGACTGTTCAAGCAAGCTACTATTGGTCCAGTCAA CACCTCCCGCCCTGGGATCTTCAACATGAAGGATAGAGCAAAGTGGGATGCTTGGAAGGCTGTTGAAGCCAAGTCCAAGGACGAAGCAATGAATGACTAC ATCACCAAGATTAAGCAACTGCTTGAAGAAGCTGCCGCAGCTAATTAG
AA sequence Show only first row Show all	>Lus10021246 pacid=23178164 polypeptide=Lus10021246 locus=Lus10021246.g ID=Lus10021246.BGIv1.0 annot-version=v1.0 MGLKIPALTQFKIWAQLFELASFPVANAKEDFEEHAQKAMTLPESTTNENKLILYGLFKQATIGPVNTSRPGIFNMKDRAKWDAWKAVEAKSKDEAMNDY ITKIKQLLEEAAAAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31812		ACBP6, ACBP	acyl-CoA-binding protein 6 (.1...		Lus10021246 [exp]	0	1
AT1G11755		LEW1	LEAF WILTING 1, Undecaprenyl p...		Lus10042338 [exp]	1.0	0.8253
AT4G39630			unknown protein		Lus10036631 [exp]	3.3	0.7592
AT1G27680		APL2	ADPGLC-PPase large subunit (.1...		Lus10010088 [exp]	6.8	0.7951
AT1G02160			Cox19 family protein (CHCH mot...		Lus10032273 [exp]	9.8	0.7587
AT2G17350			unknown protein		Lus10022984 [exp]	10.4	0.7635
AT5G19930			Protein of unknown function DU...		Lus10017753 [exp]	15.0	0.7746
AT1G47278			unknown protein		Lus10040837 [exp]	17.7	0.7118
AT3G08890			Protein of unknown function, D...		Lus10022674 [exp]	19.8	0.7643
AT1G12390			Cornichon family protein (.1)		Lus10004320 [exp]	20.5	0.7669
AT5G09830			BolA-like family protein (.1)		Lus10020861 [exp]	21.7	0.7799

Compare expression of checked genes

Lus10021246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.