Lus10021252 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62980 162 / 2e-52 FOLB2 Dihydroneopterin aldolase (.1)
AT3G11750 157 / 2e-50 FOLB1 Dihydroneopterin aldolase (.1)
AT3G21730 134 / 6e-41 FOLB3 Dihydroneopterin aldolase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013600 267 / 7e-94 AT3G11750 158 / 1e-50 Dihydroneopterin aldolase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G067200 209 / 4e-71 AT3G11750 166 / 1e-53 Dihydroneopterin aldolase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0334 THBO-biosyn PF02152 FolB Dihydroneopterin aldolase
Representative CDS sequence
>Lus10021252 pacid=23178294 polypeptide=Lus10021252 locus=Lus10021252.g ID=Lus10021252.BGIv1.0 annot-version=v1.0
ATGGAAGATCAAGAAGTAATCACTGGAGGAGATAAGCTTATACTAAGAGGCTTGAAGTTTCATGGTTTCCACGGAGTGAAACCGGAGGAGAAGTCGTTGG
GGCAGAAGTTTGTGATAGATGTAGATGCGTGGATGGATCTCCGACCAGCTGGCTTTTCTGATCAATTGGTAGACACCATTAGCTACACTGACATCTACCG
CATAGTTAAGGAAGTTGTGGAAGGGAAGCCACGGAACCTGCTGGAGACAGTGGCTCAAACTATTGCCATGACCACCTTGACGAAGCACGCTCGGATAACT
GCTGTGCGTGTGAAAGTTGAGAAGCCTCATGTTGCTGTTCATGGACCTATCGACTATCTCGGGGTTGAGATTCTGAGGCGTCGAGTTGTTGATCTGCCCA
AGTGA
AA sequence
>Lus10021252 pacid=23178294 polypeptide=Lus10021252 locus=Lus10021252.g ID=Lus10021252.BGIv1.0 annot-version=v1.0
MEDQEVITGGDKLILRGLKFHGFHGVKPEEKSLGQKFVIDVDAWMDLRPAGFSDQLVDTISYTDIYRIVKEVVEGKPRNLLETVAQTIAMTTLTKHARIT
AVRVKVEKPHVAVHGPIDYLGVEILRRRVVDLPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62980 FOLB2 Dihydroneopterin aldolase (.1) Lus10021252 0 1
AT1G55340 Protein of unknown function (D... Lus10010312 4.0 0.8753
AT1G07745 SSN1, ATRAD51D,... SUPPRESOR OF SNI1, homolog of ... Lus10005437 4.4 0.8879
AT4G31150 endonuclease V family protein ... Lus10024534 5.5 0.8694
AT2G27790 RNA-binding (RRM/RBD/RNP motif... Lus10030600 6.0 0.8821
AT5G51960 unknown protein Lus10036504 6.9 0.8528
AT1G51730 Ubiquitin-conjugating enzyme f... Lus10037613 10.7 0.8772
AT1G50575 Putative lysine decarboxylase ... Lus10016588 11.1 0.8286
AT2G23940 Protein of unknown function (D... Lus10028450 11.7 0.8624
AT1G08110 lactoylglutathione lyase famil... Lus10021429 12.2 0.8598
AT5G40410 Tetratricopeptide repeat (TPR)... Lus10021229 14.1 0.8523

Lus10021252 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.