Plant FIBer expression Database

Lus10021261 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52380 46 / 8e-07 CP33, PDE322 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013591
[exp]
160 / 2e-49 AT3G52380 130 / 4e-35 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1)
Lus10029372
[exp]
54 / 3e-09 AT3G52380 269 / 6e-89 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1)
Lus10016174
[exp]
52 / 1e-08 AT3G52380 275 / 3e-91 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1)
Poplar homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0221 RRM PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence
>Lus10021261 pacid=23178272 polypeptide=Lus10021261 locus=Lus10021261.g ID=Lus10021261.BGIv1.0 annot-version=v1.0
ATGGAGTCGAGAGCAGGGAGGGAGAGTAAGGGCTCTAGGATGCTGGTGGTAAGAAGACTTGGTTTCAAAATCGCAAAAGAATATCTTGAACAAGCGTTTA
AAGATCAGCCTGGATTCTATAAGGCTGAGATCAGGAACAGTTTGCCTACAGGGAAATATCTTGGTACTGGTCTATTGTGGTTTGAAACTGCTGAGGATGC
AGTCGCTGCTCTAAACCGCATGCAAGGAACGGTGGTGAAAGGGCAGACTTTGCTTCTGAAGAAGCCTTTGCCGAGTTCGCCACAACAGATTGTCGAGGAA
TATCAACAGAAGCAGAACAGCAAGTCATCCCATTCTAGTACCAGTTCGTGA
AA sequence
>Lus10021261 pacid=23178272 polypeptide=Lus10021261 locus=Lus10021261.g ID=Lus10021261.BGIv1.0 annot-version=v1.0
MESRAGRESKGSRMLVVRRLGFKIAKEYLEQAFKDQPGFYKAEIRNSLPTGKYLGTGLLWFETAEDAVAALNRMQGTVVKGQTLLLKKPLPSSPQQIVEE
YQQKQNSKSSHSSTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52380 CP33, PDE322 PIGMENT DEFECTIVE 322, chlorop... Lus10021261
[exp]
0 1
AT2G21370 XK1, XK-1 XYLULOSE KINASE 1, xylulose ki... Lus10041956
[exp]
12.2 0.8541
AT3G29185 Domain of unknown function (DU... Lus10032999
[exp]
13.3 0.8487
AT4G33490 Eukaryotic aspartyl protease f... Lus10020874
[exp]
20.7 0.7846
AT5G53850 haloacid dehalogenase-like hyd... Lus10005542
[exp]
29.8 0.8332
AT5G27290 unknown protein Lus10033822
[exp]
34.5 0.8294
AT2G34960 CAT5 cationic amino acid transporte... Lus10018691
[exp]
42.0 0.7722
AT3G13180 NOL1/NOP2/sun family protein /... Lus10022523
[exp]
46.1 0.7891
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10002906
[exp]
46.9 0.8206
AT5G44510 TAO1 target of AVRB operation1 (.1) Lus10001537
[exp]
50.3 0.7826
AT1G80380 P-loop containing nucleoside t... Lus10018910
[exp]
50.5 0.8154

Lus10021261 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.