Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033685 [exp] 94 / 4e-24 AT1G16480 962 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10013578 [exp] 0 / 1 AT1G16480 1036 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021271 pacid=23178275 polypeptide=Lus10021271 locus=Lus10021271.g ID=Lus10021271.BGIv1.0 annot-version=v1.0 ATGAACACAAAATTGATGAATGCACTGCTCCTCCTACATAAGGAAATAGAGCTGGCAAGTTATTGTATGGTAGAGTCTGGTGTCTCCCATGCAAACTCAG TTACAGTTGCGGACAGTTTCCTCATGCCAGAAAGCCAAATTCCTCTCATATGCTGCCTTAGGATGGCAGGAAGGTGGGTTCGTGTCTATTGCAGACCACC GGAACCCAGAGGTGTCTTGCTTCTAGCAGAAAGGATTCTCCCTGATCACGAGACAAGTTAG
AA sequence Show only first row Show all	>Lus10021271 pacid=23178275 polypeptide=Lus10021271 locus=Lus10021271.g ID=Lus10021271.BGIv1.0 annot-version=v1.0 MNTKLMNALLLLHKEIELASYCMVESGVSHANSVTVADSFLMPESQIPLICCLRMAGRWVRVYCRPPEPRGVLLLAERILPDHETS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021271 [exp]	0	1
AT5G50360			unknown protein		Lus10023397 [exp]	2.4	0.8553
AT2G25737			Sulfite exporter TauE/SafE fam...		Lus10014316 [exp]	6.0	0.8742
AT3G21100			RNA-binding (RRM/RBD/RNP motif...		Lus10027350 [exp]	10.3	0.8760
AT2G28470		BGAL8	beta-galactosidase 8 (.1.2)		Lus10006733 [exp]	16.0	0.8677
AT4G01030			pentatricopeptide (PPR) repeat...		Lus10017350 [exp]	16.2	0.8154
AT1G30670	bHLH	bHLH052	basic helix-loop-helix (bHLH) ...		Lus10005451 [exp]	17.2	0.8429
AT5G55390		EDM2	ENHANCED DOWNY MILDEW 2 (.1.2)		Lus10002269 [exp]	18.6	0.8677
AT1G01110		IQD18	IQ-domain 18 (.1.2)		Lus10008876 [exp]	20.2	0.8091
					Lus10006808 [exp]	21.8	0.8133
					Lus10008111 [exp]	21.8	0.7918

Compare expression of checked genes

Lus10021271 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.