Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019733 [exp] 67 / 4e-15 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021285 pacid=23178176 polypeptide=Lus10021285 locus=Lus10021285.g ID=Lus10021285.BGIv1.0 annot-version=v1.0 ATGGCAGTGCTGGAATGGGATCGGGATGATCGGGTAGAGTTGTCGGATTCCGGAGTTTTGGTTCTGGTGATTTGGCCGTTACCTAAGAAAGGCTATTTTG CGCGAATCACTTGCTATCTGACGTGGGTCGAAGGGTCCGGACCCGCGAACCACGTGAAAGGAAAGCCATGTGAATTCCAAGTGATTCCGCAAGAGAAGTT AGACGAGAATTGGACGAGTCTCAACCTTACGAGACATAACTAA
AA sequence Show only first row Show all	>Lus10021285 pacid=23178176 polypeptide=Lus10021285 locus=Lus10021285.g ID=Lus10021285.BGIv1.0 annot-version=v1.0 MAVLEWDRDDRVELSDSGVLVLVIWPLPKKGYFARITCYLTWVEGSGPANHVKGKPCEFQVIPQEKLDENWTSLNLTRHN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021285 [exp]	0	1
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10031172 [exp]	5.3	0.7836
					Lus10038177 [exp]	7.9	0.7115
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10040325 [exp]	8.4	0.7713
AT1G44100		AAP5	amino acid permease 5 (.1)		Lus10042742 [exp]	13.0	0.7440
AT2G34440	MADS	AGL29	AGAMOUS-like 29 (.1)		Lus10011787 [exp]	16.2	0.7273
AT3G13690			Protein kinase protein with ad...		Lus10009559 [exp]	19.2	0.7217
AT3G55400		OVA1	OVULE ABORTION 1, methionyl-tR...		Lus10001706 [exp]	20.2	0.6318
					Lus10037868 [exp]	20.3	0.7169
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10025597 [exp]	22.3	0.7123
AT5G59190			subtilase family protein (.1)		Lus10040747 [exp]	23.1	0.7160

Compare expression of checked genes

Lus10021285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.