Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000027 [exp] 123 / 3e-37 AT3G11640 63 / 8e-13 unknown protein Lus10016964 [exp] 117 / 2e-35 AT3G11640 62 / 3e-13 unknown protein Lus10016965 [exp] 117 / 1e-34 AT3G11640 69 / 7e-15 unknown protein Lus10029407 [exp] 60 / 5e-12 AT3G52480 74 / 4e-16 unknown protein Lus10004203 [exp] 51 / 1e-08 AT3G52480 77 / 3e-17 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G204400 [exp] 44 / 3e-06 AT3G52480 74 / 5e-16 unknown protein Potri.016G071700 [exp] 44 / 4e-06 AT3G52480 47 / 3e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021290 pacid=23178310 polypeptide=Lus10021290 locus=Lus10021290.g ID=Lus10021290.BGIv1.0 annot-version=v1.0 ATGGAGCTTCTCTACCTATGTTTCTGCTGCTGCTGCTGCAGCTGGAAGAATCACCAGGCCAATCGAATCGAGCCCACCGATGTCACAGTAATTACTTCCG TTGCGGTTGACGAGGAGTTGGAGGAGATGCTGAAGCTCCACCAGCTGTACGGTCTTTCGAGGGCTCTGTTCACGATCAAGGAGGAGTCGGAGAAGGAGGA CGACGGAGATTCGGTGGTGGTGATTCAGGTAGATGACGACGCAGGAGAAGATGGACTGACGCCACCGTTTACGACGCCGTTTGGTTCCCCTCCGTATTAC ACTCCTTCGCCGTCTCCTGCTCGTGACTGA
AA sequence Show only first row Show all	>Lus10021290 pacid=23178310 polypeptide=Lus10021290 locus=Lus10021290.g ID=Lus10021290.BGIv1.0 annot-version=v1.0 MELLYLCFCCCCCSWKNHQANRIEPTDVTVITSVAVDEELEEMLKLHQLYGLSRALFTIKEESEKEDDGDSVVVIQVDDDAGEDGLTPPFTTPFGSPPYY TPSPSPARD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11640			unknown protein		Lus10021290 [exp]	0	1
AT5G14620		DMT7, DRM2	domains rearranged methyltrans...		Lus10014552 [exp]	3.9	0.8270
AT3G11640			unknown protein		Lus10000027 [exp]	6.0	0.7688
AT5G07700	MYB	ATMYB76	myb domain protein 76 (.1)		Lus10019085 [exp]	6.9	0.7818
AT4G31160		DCAF1	DDB1-CUL4 associated factor 1 ...		Lus10006376 [exp]	9.2	0.7550
AT2G44830			Protein kinase superfamily pro...		Lus10028208 [exp]	10.9	0.7892
AT2G04350		LACS8	long-chain acyl-CoA synthetase...		Lus10016083 [exp]	11.5	0.7476
AT1G52140			unknown protein		Lus10037566 [exp]	12.6	0.7509
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10006665 [exp]	20.6	0.7286
AT1G70210		ATCYCD1;1, CYCD...	CYCLIN D1;1 (.1)		Lus10029194 [exp]	21.1	0.7659
AT4G29720		ATPAO5	polyamine oxidase 5 (.1)		Lus10006012 [exp]	29.1	0.7541

Compare expression of checked genes

Lus10021290 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.