Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52500 111 / 5e-30 Eukaryotic aspartyl protease family protein (.1) AT3G59080 68 / 2e-14 Eukaryotic aspartyl protease family protein (.1.2) AT2G42980 68 / 2e-14 Eukaryotic aspartyl protease family protein (.1) AT3G61820 61 / 3e-12 Eukaryotic aspartyl protease family protein (.1) AT1G01300 60 / 1e-11 Eukaryotic aspartyl protease family protein (.1) AT3G18490 57 / 7e-11 Eukaryotic aspartyl protease family protein (.1) AT1G25510 54 / 9e-10 Eukaryotic aspartyl protease family protein (.1) AT3G25700 54 / 1e-09 Eukaryotic aspartyl protease family protein (.1.2) AT2G03200 54 / 1e-09 Eukaryotic aspartyl protease family protein (.1) AT1G79720 53 / 2e-09 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016967 [exp] 195 / 4e-62 AT3G52500 330 / 2e-109 Eukaryotic aspartyl protease family protein (.1) Lus10004204 [exp] 135 / 6e-39 AT3G52500 457 / 2e-158 Eukaryotic aspartyl protease family protein (.1) Lus10029408 [exp] 132 / 8e-38 AT3G52500 466 / 5e-162 Eukaryotic aspartyl protease family protein (.1) Lus10013324 [exp] 84 / 3e-21 AT3G52500 177 / 2e-53 Eukaryotic aspartyl protease family protein (.1) Lus10005211 [exp] 82 / 2e-20 AT3G52500 179 / 2e-54 Eukaryotic aspartyl protease family protein (.1) Lus10020759 [exp] 65 / 8e-14 AT3G59080 386 / 1e-133 Eukaryotic aspartyl protease family protein (.1.2) Lus10007466 [exp] 64 / 5e-13 AT4G16563 523 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10028941 [exp] 64 / 7e-13 AT4G16563 489 / 2e-169 Eukaryotic aspartyl protease family protein (.1) Lus10007335 [exp] 62 / 2e-12 AT3G59080 698 / 0.0 Eukaryotic aspartyl protease family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G071900 [exp] 125 / 4e-35 AT3G52500 491 / 8e-172 Eukaryotic aspartyl protease family protein (.1) Potri.006G204700 [exp] 124 / 5e-35 AT3G52500 504 / 5e-177 Eukaryotic aspartyl protease family protein (.1) Potri.009G162400 [exp] 105 / 5e-28 AT3G52500 396 / 1e-134 Eukaryotic aspartyl protease family protein (.1) Potri.005G204600 [exp] 68 / 2e-14 AT3G59080 686 / 0.0 Eukaryotic aspartyl protease family protein (.1.2) Potri.015G051800 [exp] 63 / 1e-12 AT3G18490 585 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.010G128200 [exp] 62 / 3e-12 AT1G25510 622 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.014G099400 [exp] 57 / 1e-10 AT1G01300 633 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.002G171700 [exp] 57 / 2e-10 AT1G01300 642 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.008G115900 [exp] 55 / 5e-10 AT3G25700 530 / 0.0 Eukaryotic aspartyl protease family protein (.1.2) Potri.006G232400 [exp] 54 / 2e-09 AT5G10770 418 / 4e-143 Eukaryotic aspartyl protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0129 [flax] [poplar] Peptidase_AA PF00026 [flax] [poplar] Asp Eukaryotic aspartyl protease
Representative CDS sequence Show only first row Show all	>Lus10021292 pacid=23178244 polypeptide=Lus10021292 locus=Lus10021292.g ID=Lus10021292.BGIv1.0 annot-version=v1.0 ATGTCTAGTTTTAATTACACGGTTGCGAAGGATATTCAGGATCTGACCGGATTGAGGCCTTGCTTCGATGTTTCTAGCCAGGATAAGCTGAGGTTTCCTC AATTGAGCTTCAAGTTTAAAGGTGGAGCTGAGATGGAGCTTCCCGCGACGAATTATTTTGTGCTTGTGACCGAGAAGGTTATTTGTTTCACGATTGTTAG CGGGAAAGGAGGTGGCGGCGGCGGCGGGCCGGCTATAATCTTGGGGAATTATCAGCAACGGGATTATAATATCGAGTATGATTTGGAGAATGAGAGGTTT GGGTTCAAGAGGCAGAAATGTGCTTAG
AA sequence Show only first row Show all	>Lus10021292 pacid=23178244 polypeptide=Lus10021292 locus=Lus10021292.g ID=Lus10021292.BGIv1.0 annot-version=v1.0 MSSFNYTVAKDIQDLTGLRPCFDVSSQDKLRFPQLSFKFKGGAEMELPATNYFVLVTEKVICFTIVSGKGGGGGGGPAIILGNYQQRDYNIEYDLENERF GFKRQKCA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52500			Eukaryotic aspartyl protease f...		Lus10021292 [exp]	0	1
AT3G52500			Eukaryotic aspartyl protease f...		Lus10021293 [exp]	1.0	0.9063
AT1G32860			Glycosyl hydrolase superfamily...		Lus10017344 [exp]	2.4	0.8843
AT5G61760		ATIPK2BETA	ARABIDOPSIS THALIANA INOSITOL ...		Lus10009385 [exp]	4.2	0.8767
AT4G37660			Ribosomal protein L12/ ATP-dep...		Lus10023839 [exp]	6.3	0.8026
AT5G20500			Glutaredoxin family protein (....		Lus10021590 [exp]	7.7	0.8004
AT3G57400			unknown protein		Lus10018074 [exp]	8.4	0.7941
AT5G52540			Protein of unknown function (D...		Lus10039273 [exp]	11.5	0.8386
AT2G26110			Protein of unknown function (D...		Lus10019517 [exp]	16.4	0.7898
AT2G20820			unknown protein		Lus10033715 [exp]	19.0	0.8213
AT5G40150			Peroxidase superfamily protein...		Lus10039471 [exp]	19.0	0.8005

Compare expression of checked genes

Lus10021292 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.