Lus10021297 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36000 242 / 2e-78 EMB3114 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
AT2G34620 177 / 2e-53 Mitochondrial transcription termination factor family protein (.1)
AT2G03050 150 / 3e-43 SOLDAT10, EMB93 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
AT3G18870 117 / 5e-31 Mitochondrial transcription termination factor family protein (.1)
AT4G14605 95 / 2e-21 Mitochondrial transcription termination factor family protein (.1)
AT1G78930 93 / 1e-20 Mitochondrial transcription termination factor family protein (.1)
AT5G55580 89 / 1e-19 Mitochondrial transcription termination factor family protein (.1)
AT2G21710 89 / 3e-19 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
AT4G38160 63 / 4e-11 PDE191 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
AT4G02990 62 / 1e-10 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016971 545 / 0 AT2G36000 271 / 2e-89 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10029422 314 / 4e-106 AT2G36000 294 / 3e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10004219 303 / 3e-102 AT2G36000 293 / 8e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10030451 151 / 2e-43 AT2G03050 283 / 3e-95 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Lus10032120 149 / 2e-42 AT2G34620 300 / 2e-101 Mitochondrial transcription termination factor family protein (.1)
Lus10026612 148 / 4e-42 AT2G03050 285 / 4e-96 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Lus10014567 144 / 3e-40 AT2G34620 300 / 6e-101 Mitochondrial transcription termination factor family protein (.1)
Lus10026325 103 / 4e-25 AT3G18870 278 / 3e-93 Mitochondrial transcription termination factor family protein (.1)
Lus10042342 99 / 9e-24 AT3G18870 276 / 1e-92 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G072200 281 / 5e-93 AT2G36000 280 / 1e-92 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Potri.006G205000 267 / 1e-87 AT2G36000 284 / 2e-94 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Potri.011G081400 166 / 4e-49 AT2G34620 392 / 5e-138 Mitochondrial transcription termination factor family protein (.1)
Potri.010G167400 140 / 3e-39 AT2G03050 303 / 3e-103 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Potri.004G150600 117 / 6e-31 AT3G18870 311 / 1e-106 Mitochondrial transcription termination factor family protein (.1)
Potri.007G001800 100 / 4e-23 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.017G067600 99 / 1e-22 AT4G14605 571 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.001G361800 85 / 3e-18 AT5G55580 584 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.009G116200 83 / 2e-17 AT2G21710 748 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Potri.008G088100 67 / 8e-14 AT2G03050 117 / 7e-34 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10021297 pacid=23178257 polypeptide=Lus10021297 locus=Lus10021297.g ID=Lus10021297.BGIv1.0 annot-version=v1.0
ATGCAGGAAACACTCAATCTAATCTCAAAACCAGTCAAATTCCCTTACCATAATTATGATTCTCCTTCACTTTCTCGTCGCCCTAGAGCTCAGTTCAAAT
TCCCTCCCAACATCTCATCGAAGACAATTACCGCCGTCGCCGCCCCTCCGCCACCGCGGCCACCAGCTCCACCTCCACCTCCATCCGATTTCCAGGAGAA
GATCTACTACCTCGACTCAATCGGACTCGACGCGTTCTCCCTAGTCACCGACCACCGCCCAATCCTCCTATCCGCCTCTCTCTCCAACATCAAATCCGCC
ATTGAATACCTCACCACGATGGACTTCAACTCCCACGACTTCCGCCGCATCGTCACTCTGTGCCCCCAATTCCTCGCCTCCGCCAGCGCCTCCACCTTAA
TCCCGGTCTTCACCTTCCTCCTCCGCGAGGCCGGCGTCCAGCGTTGGAACATACGGCGAGTCATCCAGCGCCGCCCAAAGCTGCTCCTCTGCAGCGTGGA
GAACCAGCTCCGGCCGAGCCTGCATTTCCTCCACTCAATCGGCATCCCCACGGAGTACAGGCACGCCTACCTGCTCTGCTGCAGCGTTGAAGGGCTGCTT
GTCCCTCGGGTCCGGTACTTCCAGGACCTTGGATTATCGTACCGGGAGTCGGCGTCAATGTTCCAGAGGTGCCCGCAGCTGTTCAGTTACAGCATGAAGG
AGAACATAGTGCCGAAGCTGGAGTACTATGTGGAGGAGATGCGGAGGGAACTGAAGGAACTGAAGGAATTTCCGCAGTATTTTTCGTTCAGCTTGGAGGA
TCGGATTAAGCCTAGGCATCTTTGCTGCGTTGAGAGAGGGGTGTGTTTGCCTTTGGCGGTGTTATTGAGGACGAAGGATAGTCATTTCCGACGGAGGTTG
CAGTACCTTTCTGACTCTTTGCTTCCGTTGAGGTCTTCTCCGTTAGCCAGTGTAGATTACGAACCTCCTTCTTAG
AA sequence
>Lus10021297 pacid=23178257 polypeptide=Lus10021297 locus=Lus10021297.g ID=Lus10021297.BGIv1.0 annot-version=v1.0
MQETLNLISKPVKFPYHNYDSPSLSRRPRAQFKFPPNISSKTITAVAAPPPPRPPAPPPPPSDFQEKIYYLDSIGLDAFSLVTDHRPILLSASLSNIKSA
IEYLTTMDFNSHDFRRIVTLCPQFLASASASTLIPVFTFLLREAGVQRWNIRRVIQRRPKLLLCSVENQLRPSLHFLHSIGIPTEYRHAYLLCCSVEGLL
VPRVRYFQDLGLSYRESASMFQRCPQLFSYSMKENIVPKLEYYVEEMRRELKELKEFPQYFSFSLEDRIKPRHLCCVERGVCLPLAVLLRTKDSHFRRRL
QYLSDSLLPLRSSPLASVDYEPPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36000 EMB3114 EMBRYO DEFECTIVE 3114, Mitocho... Lus10021297 0 1
AT2G36000 EMB3114 EMBRYO DEFECTIVE 3114, Mitocho... Lus10016971 1.0 0.9479
AT4G20360 AtRab8D, AtRABE... RAB GTPase homolog E1B (.1) Lus10041946 6.3 0.9005
AT5G23140 NCLPP7, NCLPP2,... nuclear-encoded CLP protease P... Lus10013435 6.5 0.8964
AT1G26761 Arabinanase/levansucrase/inver... Lus10037153 8.0 0.8705
AT2G33855 unknown protein Lus10015404 11.5 0.8887
AT5G55740 CRR21 chlororespiratory reduction 21... Lus10004751 15.6 0.8798
AT1G74470 Pyridine nucleotide-disulphide... Lus10001642 16.4 0.8921
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10020417 17.2 0.8854
AT1G03600 PSB27 photosystem II family protein ... Lus10037438 17.6 0.8808
AT1G19740 ATP-dependent protease La (LON... Lus10006131 19.5 0.8904

Lus10021297 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.