Lus10021304 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22250 335 / 6e-116 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44260 322 / 7e-111 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G10960 278 / 2e-93 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 273 / 2e-91 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 265 / 1e-88 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G15920 256 / 9e-85 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT1G06450 132 / 4e-36 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 129 / 9e-36 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 120 / 9e-32 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 111 / 1e-28 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016980 565 / 0 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10004212 456 / 2e-163 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10034180 346 / 2e-120 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10018330 278 / 1e-93 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017123 275 / 2e-92 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10003635 273 / 1e-91 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036291 273 / 2e-91 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029417 226 / 5e-75 AT5G22250 164 / 2e-51 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 148 / 2e-42 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G205600 386 / 5e-136 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 370 / 1e-129 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 352 / 8e-123 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 342 / 8e-119 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 278 / 1e-93 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 273 / 1e-91 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G262500 269 / 4e-90 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 268 / 1e-89 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 266 / 4e-89 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 263 / 1e-87 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10021304 pacid=23178260 polypeptide=Lus10021304 locus=Lus10021304.g ID=Lus10021304.BGIv1.0 annot-version=v1.0
ATGTCTAAATCCACCGACGAAGAGTCGATCGCCTCCCCGCCGCCGCCGCCTTTTCCTTCTTCGCCCTGCCGACCTGTCATAATCCGATCGGTGTGGGCGG
AGAATCTCGTATCGGAGTTCTTGGTAATCCGGAAAGTCGTAGAAAAGTACCCGCTGATTTCCATGGACACGGAGTTCCCAGGCGTTGTGATTCGCGCGCA
GGGCGTCGAACAAAGTCATCGATCGCAGGATCCGACGGGAAGGTATGAGATCCTCAAGGCCAACGTTGATGCGCTTAAACTGATCCAGGTAGGGCTCACG
CTCGCCGATAAGGAAGGAAATTTGCCGGATCTTGGAACTGGGAATTGTTATATATGGGAATTCAATTTTCGGGATTTCGATGTGTCTTGCGACTATCATG
CTCATGACTCCGTTGACCTGTTGAGGAGGCAGGGGATGGATTTCGAGAAAAACAGAAAGGAAGGAGTTGAGGGTGTGAAATTCGCCGAGCTGATGATGTC
GTCGGGGCTGGTGTTGGATCCCTCAGTTAGTTGGGTCACATTTCACAGCGCTTATGATTTTGGTTACTTGGTGAAGTGTTTGACTCAGAAGCCTTTGCCC
GATGGCTTGACTGAGTTTCTAGATTTGGTGAGAATGTTCTTTGGGGACAACGTTTATGACATTAAGCATTTGATGAAGTTTGGGGCGAACTTGTTTGGTG
GGCTTGATAGGACATGCAAGACTTTGGGTGTGGAGCGGGTCACTGGGAAGAGTCACCAAGCTGGTTCAGATAGCTTGGCGACACTCCACGCCTTTCAGAA
AATGAGAGAGAAGTACTTCAATGGTAGGGAGGATGGAGCAATAGAAAAGTACGCAAATGTTTTATATGGATTAGAGCTGCCAACTTCATAG
AA sequence
>Lus10021304 pacid=23178260 polypeptide=Lus10021304 locus=Lus10021304.g ID=Lus10021304.BGIv1.0 annot-version=v1.0
MSKSTDEESIASPPPPPFPSSPCRPVIIRSVWAENLVSEFLVIRKVVEKYPLISMDTEFPGVVIRAQGVEQSHRSQDPTGRYEILKANVDALKLIQVGLT
LADKEGNLPDLGTGNCYIWEFNFRDFDVSCDYHAHDSVDLLRRQGMDFEKNRKEGVEGVKFAELMMSSGLVLDPSVSWVTFHSAYDFGYLVKCLTQKPLP
DGLTEFLDLVRMFFGDNVYDIKHLMKFGANLFGGLDRTCKTLGVERVTGKSHQAGSDSLATLHAFQKMREKYFNGREDGAIEKYANVLYGLELPTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Lus10021304 0 1
AT1G19440 KCS4 3-ketoacyl-CoA synthase 4 (.1) Lus10001657 3.2 0.8328
AT2G17420 NTR2, ATNTRA, N... NADPH-DEPENDENT THIOREDOXIN RE... Lus10037596 3.5 0.8336
AT5G64920 CIP8 COP1-interacting protein 8 (.1... Lus10031422 3.9 0.8235
AT5G16370 AAE5 acyl activating enzyme 5 (.1) Lus10039161 5.9 0.8083
AT2G01410 NHL domain-containing protein ... Lus10031811 6.0 0.8214
AT1G26800 RING/U-box superfamily protein... Lus10036757 6.0 0.8063
AT5G56340 ATCRT1 RING/U-box superfamily protein... Lus10010328 9.5 0.8022
AT1G34370 C2H2ZnF STOP1 sensitive to proton rhizotoxic... Lus10006071 17.3 0.7609
AT3G12400 ELC, ATELC Ubiquitin-conjugating enzyme/R... Lus10008690 19.1 0.7256
AT5G03370 acylphosphatase family (.1) Lus10026533 19.6 0.7930

Lus10021304 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.