Lus10021327 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06240 184 / 2e-60 EMB2735 embryo defective 2735 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017003 283 / 2e-99 AT5G06240 207 / 2e-69 embryo defective 2735 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G074700 216 / 7e-73 AT5G06240 215 / 2e-72 embryo defective 2735 (.1)
Potri.006G208200 60 / 2e-12 AT5G06240 67 / 2e-15 embryo defective 2735 (.1)
PFAM info
Representative CDS sequence
>Lus10021327 pacid=23178241 polypeptide=Lus10021327 locus=Lus10021327.g ID=Lus10021327.BGIv1.0 annot-version=v1.0
ATGAAGACGAAGGTGGTGATCCGTAAGCTGTACGATTACGTCCGCTACGACTTAAAAGAAATTGCTTTCCCGTCGTCTCTCCCCAACCCTCCTCACATTA
AACCACGTCCCAAATTGACCTTCTACGATCGGTTCCTTATTCTGAAGAAGGCCACTAGACTTTATTGTGCGAGCTGGGTGAGGGATATAGGTCCCGACCT
TCGCCCAAATGATTACAAGAAGCGAAAAGAGAGCGAAGATAACCCAGATGGAACAAATTCTGGAGTGAAGGAGCCATCAGTGCTTGAAGATCTTGCGGTG
GCTGCAAGAGGAGGTGCTGAGACCTTGAAACCAGCCTTGCAGAGGTTGTACATGACCAGAGCTTCTGCGTACCGAGATGCTCTGAAAAGTTTCATAGAAG
GGTATCAGGAAGGTGTCCAGCAGGTTGTGGAGAAGAAGCAAGAATCTGAAACTAGACATGAGGGAGACACTACTAAGAAATCAATATGA
AA sequence
>Lus10021327 pacid=23178241 polypeptide=Lus10021327 locus=Lus10021327.g ID=Lus10021327.BGIv1.0 annot-version=v1.0
MKTKVVIRKLYDYVRYDLKEIAFPSSLPNPPHIKPRPKLTFYDRFLILKKATRLYCASWVRDIGPDLRPNDYKKRKESEDNPDGTNSGVKEPSVLEDLAV
AARGGAETLKPALQRLYMTRASAYRDALKSFIEGYQEGVQQVVEKKQESETRHEGDTTKKSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06240 EMB2735 embryo defective 2735 (.1) Lus10021327 0 1
AT2G30330 BLOS1 BLOC subunit 1, GCN5L1 family ... Lus10030147 2.0 0.8210
AT4G04614 unknown protein Lus10006902 4.9 0.8096
AT4G00530 unknown protein Lus10037854 7.1 0.8103
AT4G28440 Nucleic acid-binding, OB-fold-... Lus10013989 7.9 0.8097
AT3G03750 SUVR3, SDG20 SET domain protein 20 (.1.2) Lus10003864 11.5 0.7651
AT2G44020 Mitochondrial transcription te... Lus10004534 14.7 0.7797
AT1G11760 MED32 unknown protein Lus10034758 15.3 0.8070
AT5G18475 Pentatricopeptide repeat (PPR)... Lus10041927 20.1 0.7549
AT3G06610 DNA-binding enhancer protein-r... Lus10037773 22.8 0.7990
AT5G49060 Heat shock protein DnaJ, N-ter... Lus10006515 23.0 0.7809

Lus10021327 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.