Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36130 259 / 4e-90 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G44600 147 / 1e-41 AtCYP71, CYP71 cyclophilin 71, cyclophilin71 (.1) AT1G01940 132 / 6e-40 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G67530 136 / 7e-38 ATPUB49 plant U-box 49 (.1) AT4G33060 117 / 2e-31 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G13120 110 / 2e-30 Pnsl5, ATCYP20-2 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) AT3G62030 109 / 9e-30 CYP20-3, ROC4 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) AT2G38730 105 / 5e-29 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G55920 105 / 2e-28 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G29960 104 / 2e-28 CYP19-4, ATCYP5, CYP5 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017010 [exp] 293 / 5e-103 AT2G36130 278 / 4e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10006271 [exp] 150 / 7e-43 AT3G44600 1110 / 0.0 cyclophilin 71, cyclophilin71 (.1) Lus10020573 [exp] 150 / 7e-43 AT3G44600 1115 / 0.0 cyclophilin 71, cyclophilin71 (.1) Lus10009237 [exp] 124 / 4e-36 AT1G01940 317 / 2e-112 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10007794 [exp] 127 / 1e-34 AT5G67530 868 / 0.0 plant U-box 49 (.1) Lus10004731 [exp] 125 / 7e-34 AT5G67530 916 / 0.0 plant U-box 49 (.1) Lus10011330 [exp] 109 / 9e-30 AT5G13120 336 / 2e-117 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) Lus10024999 [exp] 114 / 1e-29 AT4G33060 344 / 9e-112 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10020992 [exp] 110 / 2e-29 AT2G15790 598 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G075600 [exp] 270 / 2e-94 AT2G36130 278 / 3e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.009G146400 [exp] 149 / 2e-42 AT3G44600 1095 / 0.0 cyclophilin 71, cyclophilin71 (.1) Potri.002G149700 [exp] 131 / 3e-39 AT1G01940 293 / 3e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.014G071600 [exp] 127 / 5e-38 AT1G01940 293 / 2e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G148900 [exp] 130 / 1e-35 AT5G67530 806 / 0.0 plant U-box 49 (.1) Potri.003G167700 [exp] 116 / 2e-32 AT5G13120 277 / 5e-94 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) Potri.001G060200 [exp] 113 / 2e-31 AT5G13120 297 / 7e-102 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) Potri.002G185200 [exp] 113 / 3e-31 AT3G62030 293 / 2e-100 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) Potri.010G189000 [exp] 107 / 2e-29 AT3G55920 303 / 4e-105 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.003G194500 [exp] 105 / 5e-29 AT2G38730 349 / 2e-124 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [flax] [poplar] Cyclophil-like PF00160 [flax] [poplar] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Lus10021335 pacid=23178224 polypeptide=Lus10021335 locus=Lus10021335.g ID=Lus10021335.BGIv1.0 annot-version=v1.0 ATGTGGAAAGCCGCCGATGGTGGAGCACCTGAGGTGACTCTGGAGACTTCCATGGGAGCTTTCACTTTGTACTACAAGCACGCTCCAAAGACTTGCAGGA ACTTCATTGAGCTGTCCAGGAGAGGATACTACGACAATGTGAAATTCCACCGGATTATCAAGGATTTCATAGTGCAAGGTGGGGATCCGACGGGGACAGG AAGGGGTGGGGAGTCCATATACGGAAAGAAGTTTGAGGACGAGATAAAGAAGGAGTTGAAGCACACTGGGGCTGGGATTCTATCCATGGCAAATGCTGGT CCTGATACAAATGGAAGCCAGTTCTTCATTACATTGGCGCCATGCCTTTCACTAGATGGGAAACATACTATTTTCGGAAGAGTATGCTCTGGGATGGAGA TAATCAAAAGACTTGGGAGCGTCCAAACTGATAACAGTGACAGGCCCATTCATGACGTGAAGATACTAAGGACGTCTGTCAAAGATTAA
AA sequence Show only first row Show all	>Lus10021335 pacid=23178224 polypeptide=Lus10021335 locus=Lus10021335.g ID=Lus10021335.BGIv1.0 annot-version=v1.0 MWKAADGGAPEVTLETSMGAFTLYYKHAPKTCRNFIELSRRGYYDNVKFHRIIKDFIVQGGDPTGTGRGGESIYGKKFEDEIKKELKHTGAGILSMANAG PDTNGSQFFITLAPCLSLDGKHTIFGRVCSGMEIIKRLGSVQTDNSDRPIHDVKILRTSVKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36130			Cyclophilin-like peptidyl-prol...		Lus10021335 [exp]	0	1
AT4G22380			Ribosomal protein L7Ae/L30e/S1...		Lus10015295 [exp]	4.5	0.8118
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10026854 [exp]	4.9	0.8195
AT5G40080			Mitochondrial ribosomal protei...		Lus10034241 [exp]	6.3	0.7444
AT5G49210			unknown protein		Lus10036792 [exp]	8.1	0.8051
AT5G57860			Ubiquitin-like superfamily pro...		Lus10036598 [exp]	10.2	0.8057
AT5G09920		NRPB4, ATRPB15....	RNA polymerase II, Rpb4, core ...		Lus10005796 [exp]	12.2	0.7794
AT2G36130			Cyclophilin-like peptidyl-prol...		Lus10017010 [exp]	13.6	0.8220
AT3G18110		EMB1270	embryo defective 1270, Pentatr...		Lus10013785 [exp]	13.6	0.7493
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10015000 [exp]	13.7	0.8305
AT4G26310			elongation factor P (EF-P) fam...		Lus10030360 [exp]	20.8	0.7792

Compare expression of checked genes

Lus10021335 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.