Lus10021337 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G55300 244 / 3e-83 TAF7 TBP-associated factor 7 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017011 337 / 1e-119 AT1G55300 274 / 1e-94 TBP-associated factor 7 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G006300 232 / 3e-78 AT1G55300 247 / 5e-84 TBP-associated factor 7 (.1.2)
Potri.003G218700 224 / 3e-75 AT1G55300 244 / 7e-83 TBP-associated factor 7 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0662 Triple_barrel PF04658 TAFII55_N TAFII55 protein conserved region
Representative CDS sequence
>Lus10021337 pacid=23178173 polypeptide=Lus10021337 locus=Lus10021337.g ID=Lus10021337.BGIv1.0 annot-version=v1.0
ATGGAGGAACAATTCATTCTCAGAGTCCCGCCTTCCGTTGCTGAGACTATCGAAAGCCTTCTGAATGGAAGTGCATCTACTTCTGAAGAACAGTCGCTGG
ATTTGTCTTTCTCTGAGGATGGAAGGAGTGGCACATTTTCTGTTGGCAATGAGCAGTTTCCTGCATCTCTCTTGGATCTGCCTTGTGTTATAGAGTCCTT
CAAAACATATGATGACGCTGCTCTGGTTAAAACTGCAGACATTGGCCAGATGATTATGGTTAGAGGACCCAACGATTCTGCTCCAGATACAACTGAGTCC
AGACATGGGATCACTCCTCCCATGAGGGATGCTAGGAAAAGAAGATTCCGGAGAGAACCTGACCTAAATCCTGAGCTTGTACAACGTGTGGAGAGAGATC
TATTGAACATCATGACTCCAAACGAGCAAGAAGATGGCAATCAGCATGCAAGTATTGCCAATAAGAAAACTGCACCCAAGCCCGTGTCAAAGCCTGAGGC
TCCACCGGCAAAAACCAATGTTGAGGAGCCTGAGCGAAGCGACTCCGACGAATCTGAGGATTCAATGTAA
AA sequence
>Lus10021337 pacid=23178173 polypeptide=Lus10021337 locus=Lus10021337.g ID=Lus10021337.BGIv1.0 annot-version=v1.0
MEEQFILRVPPSVAETIESLLNGSASTSEEQSLDLSFSEDGRSGTFSVGNEQFPASLLDLPCVIESFKTYDDAALVKTADIGQMIMVRGPNDSAPDTTES
RHGITPPMRDARKRRFRREPDLNPELVQRVERDLLNIMTPNEQEDGNQHASIANKKTAPKPVSKPEAPPAKTNVEEPERSDSDESEDSM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G55300 TAF7 TBP-associated factor 7 (.1.2) Lus10021337 0 1
AT1G72640 NAD(P)-binding Rossmann-fold s... Lus10000373 2.2 0.8929
AT1G55300 TAF7 TBP-associated factor 7 (.1.2) Lus10017011 2.8 0.8732
AT5G57910 unknown protein Lus10022161 3.5 0.8676
AT4G20030 RNA-binding (RRM/RBD/RNP motif... Lus10006936 4.2 0.8757
AT1G08980 ATTOC64-I, ATAM... ARABIDOPSIS THALIANA TRANSLOCO... Lus10004466 4.5 0.8683
AT5G20220 zinc knuckle (CCHC-type) famil... Lus10036722 4.9 0.8866
AT5G52100 CRR1 chlororespiration reduction 1,... Lus10005771 7.3 0.8506
AT2G46090 Diacylglycerol kinase family p... Lus10036388 8.4 0.8529
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10003521 8.9 0.8471
AT5G18570 EMB3138, ATOBGL... EMBRYO DEFECTIVE 3138, EMBRYO ... Lus10006128 11.0 0.8467

Lus10021337 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.