Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 59 / 3e-12 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17140 42 / 4e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017014 [exp] 110 / 2e-33 AT1G47960 56 / 4e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016318 [exp] 105 / 3e-30 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017013 [exp] 97 / 5e-27 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017040 [exp] 84 / 5e-22 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016317 [exp] 63 / 1e-13 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016322 [exp] 56 / 2e-11 ND 39 / 4e-09 Lus10037792 [exp] 46 / 3e-07 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017076 [exp] 43 / 4e-06 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G063000 [exp] 53 / 5e-10 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.008G102600 [exp] 42 / 5e-06 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021338 pacid=23178237 polypeptide=Lus10021338 locus=Lus10021338.g ID=Lus10021338.BGIv1.0 annot-version=v1.0 ATGGTGATTTTGAACGAGATAAAGAAATTGCAAGTGACCAACCTAGAACTGAACAAGCCGCTCAAGGAATGCGCAGAGGGGTACGATGATGTGGTCCACA GCGATCACAATGAGGCCGTGGACGCGATGAGTGGTGGGGTCCCCAAATTTGGAGAGGACGCTATTAGTGACTCTCACGCTCAGCCACAAGACTGTGAGGA TTCGTTCAAAAACTATGGCAAAACATCCTTCTCAACTCCGTTGTTTACGAGATTGTCAGTGTAA
AA sequence Show only first row Show all	>Lus10021338 pacid=23178237 polypeptide=Lus10021338 locus=Lus10021338.g ID=Lus10021338.BGIv1.0 annot-version=v1.0 MVILNEIKKLQVTNLELNKPLKECAEGYDDVVHSDHNEAVDAMSGGVPKFGEDAISDSHAQPQDCEDSFKNYGKTSFSTPLFTRLSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	0	1
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	1.0	1.0000
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	2.4	1.0000
					Lus10033096 [exp]	3.0	1.0000
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	3.5	0.9928
AT4G22410			Ubiquitin C-terminal hydrolase...		Lus10035548 [exp]	4.0	0.9784
AT1G31450			Eukaryotic aspartyl protease f...		Lus10002630 [exp]	4.2	0.9817
AT3G44150			unknown protein		Lus10021005 [exp]	4.5	0.9835
AT1G07420		SMO2-1, ATSMO1,...	Arabidopsis thaliana sterol 4-...		Lus10004988 [exp]	5.1	0.9182
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10004438 [exp]	5.2	0.9723
AT5G63920		TOP3A, AtTOP3al...	topoisomerase 3alpha (.1)		Lus10006779 [exp]	5.3	0.9795

Compare expression of checked genes

Lus10021338 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.