Lus10021341 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36210 120 / 7e-36 SAUR-like auxin-responsive protein family (.1)
AT4G09530 67 / 2e-15 SAUR-like auxin-responsive protein family (.1)
AT3G43120 66 / 4e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34780 61 / 8e-13 SAUR-like auxin-responsive protein family (.1)
AT3G53250 60 / 2e-12 SAUR-like auxin-responsive protein family (.1)
AT5G20810 60 / 4e-12 SAUR-like auxin-responsive protein family (.1.2)
AT5G66260 59 / 4e-12 SAUR-like auxin-responsive protein family (.1)
AT3G51200 59 / 6e-12 SAUR-like auxin-responsive protein family (.1)
AT4G34760 58 / 1e-11 SAUR-like auxin-responsive protein family (.1)
AT1G16510 58 / 2e-11 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017018 241 / 2e-83 AT2G36210 124 / 3e-37 SAUR-like auxin-responsive protein family (.1)
Lus10034888 61 / 3e-12 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2)
Lus10031754 60 / 4e-12 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1)
Lus10031178 59 / 1e-11 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Lus10026977 59 / 2e-11 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10007553 57 / 2e-11 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1)
Lus10012189 57 / 2e-11 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1)
Lus10012185 56 / 5e-11 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Lus10007560 56 / 8e-11 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G211000 155 / 5e-50 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 66 / 4e-14 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.001G060400 65 / 2e-13 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1)
Potri.008G037900 62 / 3e-13 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.003G167400 62 / 6e-13 AT5G50760 100 / 4e-27 SAUR-like auxin-responsive protein family (.1)
Potri.009G126000 59 / 3e-12 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1)
Potri.006G137200 61 / 5e-12 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2)
Potri.004G164400 59 / 5e-12 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.018G063400 59 / 1e-11 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2)
Potri.013G111000 56 / 2e-11 AT4G09530 93 / 3e-26 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10021341 pacid=23178268 polypeptide=Lus10021341 locus=Lus10021341.g ID=Lus10021341.BGIv1.0 annot-version=v1.0
ATGCTAGGAGAAAAGATGGTGTCTTTCAGGAAACTGGCGAGAAAGGTGAAGGTTATAGCCCGGAGCAGCAGCAGCGGCAATTTCTTCGACCAATACGACA
TGTCGTCTTCGTCGTCATCGCCGCCGCATCTGGAGTGCCTGCTGGTGGAGGATGATCAGGAGGAGTCGGGAGCTGCGACGCCGATGGGGTACTTCGCGGT
GTACGTAGGGGAAGATAAAGAGAGGTATGTGGTCCCCACTGGGTTCCTGTCTCACCCTTTGTTCAAGATGTTGATGGAGAAAGCTTACAGTGACCAGCAG
AGGGACAGGCTCGTCATTCCTTGCAGCGTTTCTACGTTTCAGGAGGTTGTGAATGCTGTCCAGTGCTGCAATGGGAGGTTTGATCTCGGGAATTTGGTGG
AGGAGTTGTTGTAG
AA sequence
>Lus10021341 pacid=23178268 polypeptide=Lus10021341 locus=Lus10021341.g ID=Lus10021341.BGIv1.0 annot-version=v1.0
MLGEKMVSFRKLARKVKVIARSSSSGNFFDQYDMSSSSSSPPHLECLLVEDDQEESGAATPMGYFAVYVGEDKERYVVPTGFLSHPLFKMLMEKAYSDQQ
RDRLVIPCSVSTFQEVVNAVQCCNGRFDLGNLVEELL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36210 SAUR-like auxin-responsive pro... Lus10021341 0 1
AT2G35860 FLA16 FASCICLIN-like arabinogalactan... Lus10021247 6.7 0.9429
AT3G62020 GLP10 germin-like protein 10 (.1.2) Lus10009254 7.3 0.9562
AT4G13940 MEE58, EMB1395,... MATERNAL EFFECT EMBRYO ARREST ... Lus10043156 11.3 0.9477
AT1G05060 unknown protein Lus10030021 13.4 0.9435
AT1G58070 unknown protein Lus10015482 14.0 0.9477
AT5G56980 unknown protein Lus10025985 15.5 0.9296
AT5G61750 RmlC-like cupins superfamily p... Lus10022071 21.1 0.9429
AT5G07990 CYP75B1, D501, ... TRANSPARENT TESTA 7, CYTOCHROM... Lus10008112 21.7 0.9392
AT1G18740 Protein of unknown function (D... Lus10018883 25.3 0.9033
AT1G32100 ATPRR1 pinoresinol reductase 1 (.1) Lus10012143 27.2 0.9399

Lus10021341 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.