Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017020 [exp] 61 / 4e-13 AT5G42020 44 / 1e-05 luminal binding protein, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021343 pacid=23178228 polypeptide=Lus10021343 locus=Lus10021343.g ID=Lus10021343.BGIv1.0 annot-version=v1.0 ATGGCGGAAAAGTCCACAGTTATAGCACTCTCCCTTCTCTTCCTGTCAGGTTTGCTGATGGGTTTAGCAGTCACGGAGTGGGAAGAAGAAACGAAGAAGG AGATGTTTGATGTAACGAAAAGAATCAGCAAGGAAGAGATGGAGATTGCGTGGGCGGAGGAGATGGAGAAGGAAGCCAAGTTAGTGAGGGAGAGGATCCA TGATAGGAACTATCTAGAGAGCTATGTGAAGGACGCATAG
AA sequence Show only first row Show all	>Lus10021343 pacid=23178228 polypeptide=Lus10021343 locus=Lus10021343.g ID=Lus10021343.BGIv1.0 annot-version=v1.0 MAEKSTVIALSLLFLSGLLMGLAVTEWEEETKKEMFDVTKRISKEEMEIAWAEEMEKEAKLVRERIHDRNYLESYVKDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021343 [exp]	0	1
AT2G20760			Clathrin light chain protein (...		Lus10039815 [exp]	3.6	0.8741
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10024834 [exp]	4.7	0.8686
AT5G54250		HLM1, DND2, ATC...	DEFENSE, NO DEATH 2, cyclic nu...		Lus10010061 [exp]	9.2	0.8199
AT1G71680			Transmembrane amino acid trans...		Lus10008263 [exp]	11.4	0.8198
AT5G44680			DNA glycosylase superfamily pr...		Lus10036248 [exp]	11.9	0.8303
AT5G57970			DNA glycosylase superfamily pr...		Lus10038388 [exp]	17.0	0.8072
AT4G24140		BDG3	alpha/beta-Hydrolases superfam...		Lus10033234 [exp]	20.4	0.7441
AT1G23965			unknown protein		Lus10030641 [exp]	21.4	0.7707
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10010148 [exp]	22.4	0.7365
AT5G18430			GDSL-like Lipase/Acylhydrolase...		Lus10004774 [exp]	23.2	0.7672

Compare expression of checked genes

Lus10021343 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.