Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52620 35 / 0.0008 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022704 [exp] 52 / 7e-10 AT3G52620 45 / 2e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G211600 [exp] 44 / 7e-07 AT3G52620 55 / 5e-11 unknown protein Potri.016G078700 [exp] 43 / 2e-06 AT3G52620 44 / 5e-07 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021347 pacid=23178298 polypeptide=Lus10021347 locus=Lus10021347.g ID=Lus10021347.BGIv1.0 annot-version=v1.0 ATGGCAGCCGTTCCAGATAACAAACCATTCCCAGAGGCTGATGTCGATAAAGAACTAAATACCGCCCAAAACAAAAGAGTCGAGCCTGATTCCACTTCGT CCGACATCGCCACCTCCCTGGCCACCAAGGATAAAGCGGAGGTTCAAAAGAAGAACACATGCTGCGGAGGAGACGAGAAGAAGGATTGTGGTTGTCGTAG CAGCGGCTTGAAAAAAACGGTCATAATCTCAGTGATCGTTGCCGCCGTTGCAGCCGCTGCATTTGGCATCGCCAAAAAATTGCGAGAGAAACAAACCTGA
AA sequence Show only first row Show all	>Lus10021347 pacid=23178298 polypeptide=Lus10021347 locus=Lus10021347.g ID=Lus10021347.BGIv1.0 annot-version=v1.0 MAAVPDNKPFPEADVDKELNTAQNKRVEPDSTSSDIATSLATKDKAEVQKKNTCCGGDEKKDCGCRSSGLKKTVIISVIVAAVAAAAFGIAKKLREKQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021347 [exp]	0	1
AT3G21150	CO	EIP6, BBX32	EMF1-Interacting Protein 1, B-...		Lus10033380 [exp]	2.2	0.9232
AT4G15248	CO		B-box type zinc finger family ...		Lus10027151 [exp]	2.8	0.9165
					Lus10013471 [exp]	6.3	0.8426
AT5G66400		ATDI8, RAB18	RESPONSIVE TO ABA 18, ARABIDOP...		Lus10017977 [exp]	7.7	0.8619
AT4G14690		ELIP2	EARLY LIGHT-INDUCIBLE PROTEIN ...		Lus10039379 [exp]	10.4	0.8680
AT3G21150	CO	EIP6, BBX32	EMF1-Interacting Protein 1, B-...		Lus10034830 [exp]	10.6	0.8465
AT4G11660	HSF	AT-HSFB2B, HSFB...	HEAT SHOCK TRANSCRIPTION FACTO...		Lus10008007 [exp]	11.5	0.8585
AT5G62140			unknown protein		Lus10015008 [exp]	11.5	0.8725
AT4G27310	CO		B-box type zinc finger family ...		Lus10031593 [exp]	14.5	0.8314
AT3G52740			unknown protein		Lus10021366 [exp]	22.8	0.8337

Compare expression of checked genes

Lus10021347 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.