Lus10021349 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03910 184 / 4e-56 ABCB29, ATATH12 ARABIDOPSIS THALIANA ABC TRANSPORTER HOMOLOG 12, ATP-binding cassette B29, ABC2 homolog 12 (.1)
AT1G28010 124 / 6e-34 MDR12, ATABCB14, ABCB14, PGP14 multi-drug resistance 12, Arabidopsis thaliana ATP-binding cassette B14, ATP-binding cassette B14, P-glycoprotein 14 (.1)
AT1G27940 124 / 9e-34 ABCB13, PGP13 ATP-binding cassette B13, P-glycoprotein 13 (.1)
AT2G36910 121 / 9e-33 ATMDR1, ATPGP1, PGP1, ABCB1 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1)
AT4G25960 119 / 4e-32 ABCB2, PGP2 ATP-binding cassette B2, P-glycoprotein 2 (.1)
AT5G46540 117 / 1e-31 ABCB7, PGP7 ATP-binding cassette B7, P-glycoprotein 7 (.1)
AT3G28390 117 / 3e-31 ABCB18, PGP18 ATP-binding cassette B18, P-glycoprotein 18 (.1)
AT4G01830 117 / 3e-31 ABCB5, PGP5 ATP-binding cassette B5, P-glycoprotein 5 (.1)
AT3G28860 116 / 3e-31 ABCB19, ATMDR11, ATMDR1, PGP19, MDR11, MDR1, ATPGP19, ATABCB19 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1)
AT3G28415 116 / 3e-31 ABCB22 ATP-binding cassette B22, ABC transporter family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017024 253 / 6e-82 AT5G03910 712 / 0.0 ARABIDOPSIS THALIANA ABC TRANSPORTER HOMOLOG 12, ATP-binding cassette B29, ABC2 homolog 12 (.1)
Lus10023929 122 / 4e-33 AT2G36910 2300 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1)
Lus10032911 121 / 8e-33 AT3G28860 960 / 0.0 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1)
Lus10039458 120 / 1e-32 AT3G28345 1835 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1)
Lus10015595 120 / 1e-32 AT3G28860 971 / 0.0 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1)
Lus10004571 119 / 3e-32 AT4G25960 1732 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1)
Lus10005839 119 / 3e-32 AT3G28345 1834 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1)
Lus10000910 119 / 3e-32 AT4G25960 808 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1)
Lus10020905 119 / 7e-32 AT3G28860 988 / 0.0 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G211700 188 / 2e-57 AT5G03910 709 / 0.0 ARABIDOPSIS THALIANA ABC TRANSPORTER HOMOLOG 12, ATP-binding cassette B29, ABC2 homolog 12 (.1)
Potri.018G141300 122 / 4e-33 AT3G28345 1093 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1)
Potri.003G094400 122 / 4e-33 AT4G25960 2000 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1)
Potri.016G093600 121 / 7e-33 AT2G36910 2120 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1)
Potri.006G123900 120 / 2e-32 AT2G36910 2138 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1)
Potri.001G139600 118 / 6e-32 AT4G25960 1962 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1)
Potri.006G074400 118 / 8e-32 AT3G28345 1243 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1)
Potri.015G136700 118 / 8e-32 AT4G25450 953 / 0.0 ARABIDOPSIS THALIANA NON-INTRINSIC ABC PROTEIN 8, ATP-binding cassette B28, non-intrinsic ABC protein 8 (.1.2.3)
Potri.002G019600 118 / 9e-32 AT1G27940 1654 / 0.0 ATP-binding cassette B13, P-glycoprotein 13 (.1)
Potri.001G139700 117 / 1e-31 AT4G25960 1875 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00005 ABC_tran ABC transporter
Representative CDS sequence
>Lus10021349 pacid=23178291 polypeptide=Lus10021349 locus=Lus10021349.g ID=Lus10021349.BGIv1.0 annot-version=v1.0
ATGGCTGCACGAAATGCAAATGCAGATGAATTCATTAAGATGCTTCCTAAGGGATATGAAACAAGTGTTGGACCAAGGGGCTCAAGCTTGAGTGGAGGCC
AAAAGCAAAGGCTCGCTATCGCAAGGGCCATCTATCAGGATGCTGCTATATTGATCTTGGATGAGGCAACTTCTGCCTTGGACAGCAAGTCTGAGTTGCT
GGTGAGACAAGCTCTGGAGCGGCTAACAAAAAATCACACGGTGCTGGTGATTGCCCACCGGCTGGAGACCGTCCTGATGGCGAACCGAATATTGCTTCTT
GATAAAGGGGAGCTTCGGGAGATTAGTCGATCGAGTATTCTGAATGAACACCAAACCTACATGGCGTCGAACGAGATCGTTATCTGA
AA sequence
>Lus10021349 pacid=23178291 polypeptide=Lus10021349 locus=Lus10021349.g ID=Lus10021349.BGIv1.0 annot-version=v1.0
MAARNANADEFIKMLPKGYETSVGPRGSSLSGGQKQRLAIARAIYQDAAILILDEATSALDSKSELLVRQALERLTKNHTVLVIAHRLETVLMANRILLL
DKGELREISRSSILNEHQTYMASNEIVI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03910 ABCB29, ATATH12 ARABIDOPSIS THALIANA ABC TRANS... Lus10021349 0 1
AT4G00050 bHLH bHLH016, UNE10 unfertilized embryo sac 10, ba... Lus10042874 1.4 0.8560
AT5G03910 ABCB29, ATATH12 ARABIDOPSIS THALIANA ABC TRANS... Lus10021348 2.4 0.8319
AT3G18830 ATPMT5, AtPLT5 ARABIDOPSIS THALIANA POLYOL/MO... Lus10040482 4.2 0.8140
AT3G10970 Haloacid dehalogenase-like hyd... Lus10029053 12.9 0.7605
AT1G78510 SPS1 solanesyl diphosphate synthase... Lus10005570 13.4 0.7779
AT3G57450 unknown protein Lus10019730 16.4 0.7456
AT2G04790 unknown protein Lus10012354 26.6 0.7986
AT1G75100 JAC1 J-domain protein required for ... Lus10032709 29.9 0.7824
AT2G36895 unknown protein Lus10001393 30.8 0.7389
AT1G79510 Uncharacterized conserved prot... Lus10001766 31.4 0.8078

Lus10021349 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.