Plant FIBer expression Database

Lus10021364 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52730 91 / 2e-26 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017043
[exp]
122 / 1e-38 AT3G52730 91 / 2e-26 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Lus10022716
[exp]
115 / 5e-36 AT3G52730 94 / 1e-27 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Lus10014198
[exp]
114 / 1e-35 AT3G52730 94 / 2e-27 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G188700
[exp]
89 / 1e-25 AT3G52730 122 / 2e-38 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
Potri.009G149300
[exp]
88 / 4e-25 AT3G52730 117 / 2e-36 ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Representative CDS sequence
>Lus10021364 pacid=23178190 polypeptide=Lus10021364 locus=Lus10021364.g ID=Lus10021364.BGIv1.0 annot-version=v1.0
ATGGAGCACATACAGCGAAGGCGTCAAGGAGGCCTCTTTGAGGGCATCTACAAGGTTTTCATGCGCCGTACCTCCGTCTACGCTACCTTCGTCCTCGCGG
GTGCTTTCTTCGGTGAACGGGCCGTGGATTATGGAGTTCATAAGCTGTGGGAACACAACAATGTGGGGGTACTGCTCTAG
AA sequence
>Lus10021364 pacid=23178190 polypeptide=Lus10021364 locus=Lus10021364.g ID=Lus10021364.BGIv1.0 annot-version=v1.0
MEHIQRRRQGGLFEGIYKVFMRRTSVYATFVLAGAFFGERAVDYGVHKLWEHNNVGVLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52730 ubiquinol-cytochrome C reducta... Lus10021364
[exp]
0 1
AT5G53560 B5#2, ATB5-A, A... ARABIDOPSIS CYTOCHROME B5 ISOF... Lus10005992
[exp]
6.6 0.8484
AT3G11780 MD-2-related lipid recognition... Lus10013366
[exp]
11.6 0.8468
AT5G64260 EXL2, MSJ1.10 EXORDIUM like 2 (.1) Lus10036484
[exp]
12.5 0.8173
AT2G19830 VPS32, SNF7.2 SNF7 family protein (.1) Lus10032705
[exp]
12.8 0.8372
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Lus10037450
[exp]
17.9 0.8138
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10021385
[exp]
21.4 0.8223
AT4G10265 Wound-responsive family protei... Lus10004297
[exp]
22.1 0.7670
AT2G19460 Protein of unknown function (D... Lus10011939
[exp]
22.8 0.8195
AT2G19830 VPS32, SNF7.2 SNF7 family protein (.1) Lus10012921
[exp]
23.5 0.8229
AT2G02870 Galactose oxidase/kelch repeat... Lus10030489
[exp]
25.7 0.8186

Lus10021364 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.