Lus10021379 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52820 98 / 9e-24 ATPAP22, PAP22 purple acid phosphatase 22 (.1)
AT3G52810 81 / 9e-18 ATPAP21, PAP21 purple acid phosphatase 21 (.1)
AT3G20500 75 / 1e-15 ATPAP18, PAP18 purple acid phosphatase 18 (.1)
AT3G52780 55 / 7e-09 ATPAP20, PAP20 Purple acid phosphatases superfamily protein (.1.2)
AT5G34850 55 / 1e-08 ATPAP26, PAP26 purple acid phosphatase 26 (.1)
AT4G13700 53 / 4e-08 ATPAP23, PAP23 purple acid phosphatase 23 (.1)
AT2G16430 49 / 5e-07 ATPAP10, PAP10 purple acid phosphatase 10 (.1.2)
AT2G27190 49 / 7e-07 ATPAP12 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 1, purple acid phosphatase 12 (.1)
AT2G18130 49 / 7e-07 PAP11, ATPAP11 purple acid phosphatase 11 (.1)
AT3G46120 49 / 9e-07 ATPAP19, PAP19 purple acid phosphatase 19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017059 173 / 5e-52 AT3G52820 536 / 0.0 purple acid phosphatase 22 (.1)
Lus10021378 108 / 7e-27 AT3G52820 597 / 0.0 purple acid phosphatase 22 (.1)
Lus10021377 80 / 4e-17 AT3G52820 603 / 0.0 purple acid phosphatase 22 (.1)
Lus10019625 79 / 4e-17 AT3G20500 673 / 0.0 purple acid phosphatase 18 (.1)
Lus10040079 74 / 4e-15 AT3G20500 686 / 0.0 purple acid phosphatase 18 (.1)
Lus10017060 61 / 1e-11 AT2G38600 216 / 2e-71 HAD superfamily, subfamily IIIB acid phosphatase (.1)
Lus10017056 62 / 5e-11 AT3G52780 562 / 0.0 Purple acid phosphatases superfamily protein (.1.2)
Lus10021376 54 / 3e-08 AT3G52780 539 / 0.0 Purple acid phosphatases superfamily protein (.1.2)
Lus10017057 53 / 4e-08 AT3G52780 375 / 1e-129 Purple acid phosphatases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G030700 96 / 5e-23 AT3G52820 607 / 0.0 purple acid phosphatase 22 (.1)
Potri.011G138200 79 / 4e-17 AT3G20500 696 / 0.0 purple acid phosphatase 18 (.1)
Potri.001G423700 76 / 9e-16 AT3G20500 701 / 0.0 purple acid phosphatase 18 (.1)
Potri.002G029300 51 / 2e-07 AT2G16430 693 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.018G123700 50 / 3e-07 AT5G34850 762 / 0.0 purple acid phosphatase 26 (.1)
Potri.006G063700 50 / 3e-07 AT5G34850 798 / 0.0 purple acid phosphatase 26 (.1)
Potri.003G176000 50 / 4e-07 AT4G13700 739 / 0.0 purple acid phosphatase 23 (.1)
Potri.017G055800 50 / 5e-07 AT3G07130 677 / 0.0 purple acid phosphatase 15 (.1)
Potri.017G055900 50 / 5e-07 AT3G07130 816 / 0.0 purple acid phosphatase 15 (.1)
Potri.018G024800 50 / 6e-07 AT5G34850 742 / 0.0 purple acid phosphatase 26 (.1)
PFAM info
Representative CDS sequence
>Lus10021379 pacid=23178287 polypeptide=Lus10021379 locus=Lus10021379.g ID=Lus10021379.BGIv1.0 annot-version=v1.0
ATGGAAAGCCCCTACGCATCAACCAACTTTGAACTGCATCCACTTTCTCCTGGAGTCCTCCTCTTCACTCCCCACACTCGATCTGCATCTGATCCTCAAC
AGGTCCACATATCAACTGCTGGGAAAGATCACATGACAGTCACCTGGATAACTGACCACCAAACCGTCCATTCCACCGTTGAATATGGAACTCAACCGGG
AAAGTACTCGGCTAAGGTTACTGGCAACCACCGGAGTTCGTTTCGGTTCTTAACCTATATCTCAGAGTCCATTCACCATGTGAAGATCGGACCTTTGAAT
CAAGGGCATGGTGAAACCATGAGGGTGGCTATGGAAGAGATGTTGTATAAGGCCAAAGTTGACATTGTCTTCGCAGGACATGTTCATGCATATGAAAGAT
TCGTAAGGTACAAAGTACATGGGGTTAGGAAACTTAAAGGTCCGGTTACCCAAAGAACGACCCGTAAGATCGCTCCACTGATCCCCAACATCCCCCCATA
TCCTGTACCCTTCATCAGCAGCCTCCTCATCTCCGACTTGTACACCACCGCAGTCTGCCCCTTGTACGACGCCGTCCTCAGTTCGCTCATACCCCACGAA
CCCCTGGCGATCCAGGTTAAGACGCGTGGCATCTCCAAGCCCTTCCTCGTCCCTTCCGCTAAATGA
AA sequence
>Lus10021379 pacid=23178287 polypeptide=Lus10021379 locus=Lus10021379.g ID=Lus10021379.BGIv1.0 annot-version=v1.0
MESPYASTNFELHPLSPGVLLFTPHTRSASDPQQVHISTAGKDHMTVTWITDHQTVHSTVEYGTQPGKYSAKVTGNHRSSFRFLTYISESIHHVKIGPLN
QGHGETMRVAMEEMLYKAKVDIVFAGHVHAYERFVRYKVHGVRKLKGPVTQRTTRKIAPLIPNIPPYPVPFISSLLISDLYTTAVCPLYDAVLSSLIPHE
PLAIQVKTRGISKPFLVPSAK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52820 ATPAP22, PAP22 purple acid phosphatase 22 (.1... Lus10021379 0 1

Lus10021379 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.