Lus10021381 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035750 40 / 0.0002 AT1G51640 177 / 4e-51 exocyst subunit exo70 family protein G2 (.1)
Lus10025720 39 / 0.0003 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021381 pacid=23178182 polypeptide=Lus10021381 locus=Lus10021381.g ID=Lus10021381.BGIv1.0 annot-version=v1.0
ATGGCAGCAACGTTGGGCACTCCACAAGCGGGTATGTTGGCGAAGACGCTAGGCAAATTGTTCATACAGCTGTGCTCGAGGCCATTCTATCTTGGACATG
TGATTCTTCTTCGGATAATGCATCATTTTGTGACCTTGGTGGCCCATTCCCGTGCTGGCCACATCAGTTTGACATTCGGAGGCTCTATTGTTAGGGAGAT
ATGCCAGCGGTTCTCGTCTCTGTTAGAGATTCATCTGCAGATTATTCGGCGGTTAAGTAATAGAGCCGTCCATTATATGGTATGCGAGAATGAAGTCTTG
ACCAGTTTAGCCTTGCAGCGAGTTTGCCGCTCGCCGTTCTTGCCTGCTCACCGCTTTGTGACGTTGCTGTTTGGTGATTCACGGTTCCAGACAAAAGTGT
ATGGCGTAGGAGCGTCAATGGACGATCATAATTTCTATTATTAA
AA sequence
>Lus10021381 pacid=23178182 polypeptide=Lus10021381 locus=Lus10021381.g ID=Lus10021381.BGIv1.0 annot-version=v1.0
MAATLGTPQAGMLAKTLGKLFIQLCSRPFYLGHVILLRIMHHFVTLVAHSRAGHISLTFGGSIVREICQRFSSLLEIHLQIIRRLSNRAVHYMVCENEVL
TSLALQRVCRSPFLPAHRFVTLLFGDSRFQTKVYGVGASMDDHNFYY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021381 0 1
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Lus10020511 1.4 0.9577
AT5G03100 F-box/RNI-like superfamily pro... Lus10029952 2.0 0.9574
Lus10028673 3.0 0.8798
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10021393 3.2 0.8593
AT3G22400 ATLOX5, LOX5 Arabidopsis thaliana lipoxygen... Lus10008041 3.5 0.8376
AT3G13890 MYB ATMYB26, MS35 MALE STERILE 35, myb domain pr... Lus10015608 4.0 0.8618
AT1G65440 GTB1 global transcription factor gr... Lus10034231 4.0 0.8008
AT1G60830 RNA-binding (RRM/RBD/RNP motif... Lus10011201 5.2 0.7647
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10021638 11.4 0.6940
AT3G14620 CYP72A8 "cytochrome P450, family 72, s... Lus10026179 12.1 0.8129

Lus10021381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.