Lus10021385 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64230 303 / 1e-107 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G41700 300 / 2e-106 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT4G27960 298 / 1e-105 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G53300 296 / 4e-105 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT3G08690 290 / 7e-103 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 281 / 3e-99 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G16740 276 / 6e-97 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 250 / 1e-86 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 167 / 1e-53 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 153 / 2e-48 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022726 302 / 3e-107 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 302 / 3e-107 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 298 / 1e-105 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 298 / 1e-105 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 296 / 3e-105 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 296 / 3e-105 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10033937 293 / 6e-104 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10032352 293 / 1e-103 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10027846 285 / 1e-100 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G138900 300 / 1e-106 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 300 / 1e-106 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.019G131400 300 / 1e-106 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 298 / 6e-106 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G094900 297 / 2e-105 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.012G033000 296 / 5e-105 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 296 / 5e-105 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.011G168200 291 / 3e-103 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G471200 288 / 5e-102 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.004G175000 285 / 9e-101 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10021385 pacid=23178308 polypeptide=Lus10021385 locus=Lus10021385.g ID=Lus10021385.BGIv1.0 annot-version=v1.0
ATGGCTTCTAAGCGTATCCTCAAGGAGCTCAAGGATTTGCAGAAGGATCCTCCCTCTTCCTGCAGCGCAGGTCCTGTGGCGGAGGACATGTTCCACTGGC
AGGCAACGATCATGGGACCCTCTGACAGTCCTTATTCTGGAGGTGTTTTCCTGGTTACAATCCATTTCCCTCCAGATTATCCTTTCAAGCCTCCCAAGGT
AGCATTTAGGACCAAGGTCTTTCACCCCAATGTAAACAGCAATGGGAGCATTTGTCTTGATATCCTGAAAGAGCAGTGGAGCCCAGCTCTTACCATTTCA
AAGGTACTGCTGTCAATATGCTCACTATTGACGGATCCCAACCCGGACGACCCTCTGGTGCCAGAGATTGCACACATGTACAAGACAGACCGTGCCAAAT
ACGAGGCGACTGCATGCAGCTGGACTCAGAAATATGCCATGGGATGA
AA sequence
>Lus10021385 pacid=23178308 polypeptide=Lus10021385 locus=Lus10021385.g ID=Lus10021385.BGIv1.0 annot-version=v1.0
MASKRILKELKDLQKDPPSSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATACSWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10021385 0 1
AT5G50430 UBC33 ubiquitin-conjugating enzyme 3... Lus10037459 1.0 0.9116
AT1G43130 LCV2 like COV 2 (.1) Lus10018868 1.4 0.9033
AT2G06530 VPS2.1 SNF7 family protein (.1) Lus10037660 4.6 0.8948
AT5G40370 GRXC2 glutaredoxin C2, Glutaredoxin ... Lus10022253 5.5 0.8745
AT1G68090 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5... Lus10009225 5.9 0.8770
AT5G07920 ATDGK1, DGK1 DIACYLGLYCEROL KINASE 1, diacy... Lus10034702 6.0 0.8621
AT5G09260 VPS20.2 vacuolar protein sorting-assoc... Lus10037699 7.7 0.8813
AT3G09830 Protein kinase superfamily pro... Lus10013812 8.3 0.8465
AT2G31510 ATARI7, ARI7 ARABIDOPSIS ARIADNE 7, ARIADNE... Lus10027027 9.5 0.8642
AT2G04410 RPM1-interacting protein 4 (RI... Lus10022524 11.2 0.8573

Lus10021385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.