Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22870 129 / 2e-37 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G08160 119 / 2e-33 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 75 / 3e-16 NHL2 NDR1/HIN1-like 2 (.1) AT2G35980 75 / 3e-16 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G53730 69 / 3e-14 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06320 69 / 4e-14 NHL3 NDR1/HIN1-like 3 (.1) AT5G22200 66 / 4e-13 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G44220 65 / 8e-13 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35460 65 / 1e-12 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G21130 65 / 2e-12 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016161 [exp] 349 / 4e-124 AT5G22870 148 / 8e-45 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10041350 [exp] 162 / 1e-51 AT5G22870 94 / 3e-25 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10005216 [exp] 82 / 8e-19 AT2G27260 152 / 2e-45 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034173 [exp] 79 / 1e-17 AT2G27260 149 / 2e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021287 [exp] 77 / 3e-17 AT2G35980 236 / 7e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016962 [exp] 77 / 3e-17 AT2G35980 237 / 3e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10043411 [exp] 77 / 5e-17 AT2G27260 148 / 6e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 73 / 9e-16 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007364 [exp] 60 / 1e-10 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G003800 [exp] 172 / 1e-54 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G158900 [exp] 77 / 8e-17 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.016G071600 [exp] 69 / 5e-14 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G145500 [exp] 69 / 7e-14 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1) Potri.012G006000 [exp] 67 / 9e-14 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 67 / 2e-13 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G002400 [exp] 66 / 3e-13 AT5G53730 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G197600 [exp] 67 / 4e-13 AT2G27080 264 / 8e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.015G148200 [exp] 67 / 4e-13 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1) Potri.009G019600 [exp] 63 / 4e-12 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [flax] [poplar] E-set PF03168 [flax] [poplar] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10021404 pacid=23179142 polypeptide=Lus10021404 locus=Lus10021404.g ID=Lus10021404.BGIv1.0 annot-version=v1.0 ATGACAAACCCTCTTCGTCGGCCGACGACAACGGCCACAACCGCGGCAACTACGACGCCGTATCCACCAAAGAGGAATAGCTTCCTCACCCTGATCATCT TCGCCATATTGGGCCTGATCGTCATACTGGGCCTGGCCTTCCTCATAACCTGGCTAGCCGTGAAGCCCAAAAGCCTGGTCTTCACAATCGACGACGCATC GATCCGAAATTTCAACCTGAAAAACGACCACGTCAACGGGTCGTTTTACTTCGACATCCGGGCCCGCAACCCGAACAAGCACATGAAGGTCTACTACGAC GCTGTGGAGGTCTCCACGGCGTTCGATGGGCAGAGCGTCGCCTTTGCCAAGCTGGCCCCTTTCCGCCAGCCAAAGCGGAACGTGACGTTGCTCGAGACCA GGCTGGACTCGCGTGACGTGGCGCTGGCACACTGGCTGTCGAAGGACGTGTATGCGCAGTGGCATTCGGGTCAGGTGAAGATGAATGTGAGGATCAAGGC GAAGATTCGATTCAAGGTCGGATCGATCCGGTGGAGGAAGAAGACGGTCCGGGTGCTCTGCCCGGCTGTGCCCATCAGTTTACGCCAAGGTCAGAGCTTC CAGAAGGTTGACTGTGATATGGGTTATTGA
AA sequence Show only first row Show all	>Lus10021404 pacid=23179142 polypeptide=Lus10021404 locus=Lus10021404.g ID=Lus10021404.BGIv1.0 annot-version=v1.0 MTNPLRRPTTTATTAATTTPYPPKRNSFLTLIIFAILGLIVILGLAFLITWLAVKPKSLVFTIDDASIRNFNLKNDHVNGSFYFDIRARNPNKHMKVYYD AVEVSTAFDGQSVAFAKLAPFRQPKRNVTLLETRLDSRDVALAHWLSKDVYAQWHSGQVKMNVRIKAKIRFKVGSIRWRKKTVRVLCPAVPISLRQGQSF QKVDCDMGY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22870			Late embryogenesis abundant (L...		Lus10021404 [exp]	0	1
AT5G22870			Late embryogenesis abundant (L...		Lus10016161 [exp]	1.0	0.9885
AT3G20570		AtENODL9	early nodulin-like protein 9 (...		Lus10011158 [exp]	3.5	0.9664
AT1G14730			Cytochrome b561/ferric reducta...		Lus10031935 [exp]	3.5	0.9645
AT3G20570		AtENODL9	early nodulin-like protein 9 (...		Lus10043063 [exp]	5.0	0.9556
AT1G14730			Cytochrome b561/ferric reducta...		Lus10034427 [exp]	5.2	0.9348
AT5G04890		RTM2	RESTRICTED TEV MOVEMENT 2, HSP...		Lus10028874 [exp]	5.3	0.9587
AT1G23530			unknown protein		Lus10013015 [exp]	5.7	0.9207
AT3G05620			Plant invertase/pectin methyle...		Lus10020677 [exp]	8.5	0.9401
AT1G79480			Carbohydrate-binding X8 domain...		Lus10001764 [exp]	10.2	0.9240
AT3G07420		ATNS2, SYNC2_AR...	SYNTHETASE C2, asparaginyl-tRN...		Lus10025874 [exp]	10.4	0.9289

Compare expression of checked genes

Lus10021404 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.