Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27970 147 / 7e-48 CKS2 CDK-subunit 2 (.1) AT2G27960 145 / 3e-47 CKS1AT, CKS1 cyclin-dependent kinase-subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016159 [exp] 158 / 4e-52 AT2G27970 154 / 1e-50 CDK-subunit 2 (.1) Lus10041349 [exp] 149 / 3e-48 AT2G27970 154 / 2e-50 CDK-subunit 2 (.1) Lus10036579 [exp] 84 / 3e-21 AT2G27970 86 / 2e-21 CDK-subunit 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G004000 [exp] 148 / 2e-48 AT2G27960 166 / 2e-55 cyclin-dependent kinase-subunit 1 (.1) Potri.004G217500 [exp] 145 / 5e-47 AT2G27970 152 / 3e-50 CDK-subunit 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01111 [flax] [poplar] CKS Cyclin-dependent kinase regulatory subunit
Representative CDS sequence Show only first row Show all	>Lus10021405 pacid=23179214 polypeptide=Lus10021405 locus=Lus10021405.g ID=Lus10021405.BGIv1.0 annot-version=v1.0 ATGGGGCAGATCCAGTACTCTGAGAAGTATTTCGACGACACCTACGAGTACAGGCACGTTGTTCTTACTCCTGAAGTGGCCAAACTGCTTCCTAAGAATC GCCTCCTCACTGAGAACGAGTGGCGTGCAATCGGGGTTCAACAGAGCCGAGGATGGGTGCACTATGCGATCCACCGTCCGGAGCCACACATCATGCTTTT CAGGAGGCCTTTGAACTACCAGCAGCAACAGGAGGCTGCAGCTCAAGCCCAGCAGCAAACCATGGTCGCTTAA
AA sequence Show only first row Show all	>Lus10021405 pacid=23179214 polypeptide=Lus10021405 locus=Lus10021405.g ID=Lus10021405.BGIv1.0 annot-version=v1.0 MGQIQYSEKYFDDTYEYRHVVLTPEVAKLLPKNRLLTENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQEAAAQAQQQTMVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10021405 [exp]	0	1
AT1G76860			Small nuclear ribonucleoprotei...		Lus10011293 [exp]	2.0	0.8840
AT2G30620			winged-helix DNA-binding trans...		Lus10022001 [exp]	2.4	0.8732
AT5G14640		ATSK13	shaggy-like kinase 13 (.1)		Lus10013088 [exp]	4.9	0.8822
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10034487 [exp]	5.2	0.8860
AT1G76860			Small nuclear ribonucleoprotei...		Lus10040487 [exp]	5.5	0.8739
AT5G06680		ATSPC98, SPC98,...	ARABIDOPSIS THALIANA GAMMA TUB...		Lus10029297 [exp]	5.7	0.8716
AT2G47640			Small nuclear ribonucleoprotei...		Lus10030367 [exp]	5.9	0.8724
AT5G61220			LYR family of Fe/S cluster bio...		Lus10021653 [exp]	7.3	0.8321
AT2G30620			winged-helix DNA-binding trans...		Lus10042541 [exp]	9.3	0.8161
AT1G07070			Ribosomal protein L35Ae family...		Lus10021121 [exp]	10.6	0.8518

Compare expression of checked genes

Lus10021405 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.