Lus10021408 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G45980 178 / 7e-57 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G46030 177 / 1e-56 HTB11 Histone superfamily protein (.1)
AT5G59910 176 / 5e-56 HTB4 Histone superfamily protein (.1)
AT2G28720 174 / 3e-55 Histone superfamily protein (.1)
AT5G22880 170 / 9e-54 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT1G07790 169 / 2e-53 HTB1 Histone superfamily protein (.1)
AT2G37470 163 / 3e-51 Histone superfamily protein (.1)
AT3G53650 162 / 8e-51 Histone superfamily protein (.1)
AT5G02570 154 / 1e-47 Histone superfamily protein (.1)
AT3G09480 149 / 7e-46 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016156 186 / 4e-60 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 182 / 9e-59 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10037371 174 / 2e-55 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10041347 173 / 3e-55 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10017456 170 / 7e-54 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10028826 171 / 3e-53 AT2G28720 216 / 3e-72 Histone superfamily protein (.1)
Lus10017292 168 / 4e-53 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10023753 166 / 3e-52 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Lus10005897 166 / 6e-52 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G091200 175 / 1e-55 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091400 173 / 4e-55 AT2G28720 186 / 1e-61 Histone superfamily protein (.1)
Potri.017G123700 172 / 7e-55 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.009G028001 172 / 8e-55 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G230701 171 / 3e-54 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.010G231300 170 / 7e-54 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G030400 169 / 1e-53 AT5G59910 191 / 2e-63 Histone superfamily protein (.1)
Potri.008G030600 169 / 2e-53 AT5G59910 188 / 2e-62 Histone superfamily protein (.1)
Potri.008G030500 167 / 7e-53 AT5G59910 190 / 4e-63 Histone superfamily protein (.1)
Potri.008G029900 166 / 2e-52 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10021408 pacid=23179216 polypeptide=Lus10021408 locus=Lus10021408.g ID=Lus10021408.BGIv1.0 annot-version=v1.0
ATGGCGCCCAAAGCAGAGAAGAAGCCAGCGGAGAAGAAGCCCGCCGAGAAGGCCCCAATCGCCGAGAAGAAGCCCCGCGCCGAGAAGAAGCTCCCCAAAG
AAGCCGGAACTGCAGGTGCTGACAAGAAGAAGAAGAAGAACAAGAAGAGCGTCGAGACTTACAAGATCTACATCTTCAAGGTTCTGAAGCAGGTGCACCC
GGACATCGGGATCTCCAGCAAGGCCATGGGCATCATGAACAGCTTCATCAACGACATCTTCGAGAAGCTAGCTGCTGAGTCCTCCAGGCTTGCGAGGTAT
AATAAGAAGCCGACGATTACTTCCAGGGAGATCCAGACTGCTGTGAGGCTTGTTCTTCCAGGGGAGTTGGCGAAGCATGCTGTTTCTGAAGGTTATGAAC
AGAGTGGTTCGAGGACTGGAAGTAATTCGAGAGACTCGAGATCAGCCACAACGGACGTGCCCTGTGGCTCTTCTCCTTCTCAATCATTTATATACAAATC
GCTTGATCCTAACAAGTCGGCATACGACCGGTCTGGGGAAGGTTCTCCTTCTGGTGGCAATGGTCCTCCAGTCAGTGTCGCCGGCGATCATGGAACTCCA
GCAGCACCTGGTTCAACTACACGTATAACAAGTTTCATCCTTTTCCTCCCGACCGGAGAGCGCCTCCGAAATCTAAGGATACAGCAAACAAATAAAGATA
TTTTTTGTTGA
AA sequence
>Lus10021408 pacid=23179216 polypeptide=Lus10021408 locus=Lus10021408.g ID=Lus10021408.BGIv1.0 annot-version=v1.0
MAPKAEKKPAEKKPAEKAPIAEKKPRAEKKLPKEAGTAGADKKKKKNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAAESSRLARY
NKKPTITSREIQTAVRLVLPGELAKHAVSEGYEQSGSRTGSNSRDSRSATTDVPCGSSPSQSFIYKSLDPNKSAYDRSGEGSPSGGNGPPVSVAGDHGTP
AAPGSTTRITSFILFLPTGERLRNLRIQQTNKDIFC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10021408 0 1
AT1G07820 Histone superfamily protein (.... Lus10015492 1.0 0.9649
AT1G27950 LTPG1 glycosylphosphatidylinositol-a... Lus10015779 3.7 0.9572
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10013544 4.2 0.9544
AT1G08880 HTA5 ,G-H2AX ,G... histone H2A 5, gamma histone v... Lus10028044 4.5 0.9530
AT3G54560 HTA11 histone H2A 11 (.1) Lus10018753 5.5 0.9527
AT1G71760 unknown protein Lus10030260 7.7 0.9419
AT4G13690 unknown protein Lus10000756 7.9 0.9441
AT3G13960 GRF ATGRF5 growth-regulating factor 5 (.1... Lus10000473 9.8 0.9515
AT2G26520 unknown protein Lus10021765 10.6 0.9381
AT1G54690 HTA3 ,G-H2AX ,G... histone H2A 3, GAMMA H2AX, gam... Lus10003750 11.0 0.9393

Lus10021408 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.